KEGG   Scleropages formosus (Asian bonytongue): 108933171Help
Entry
108933171         CDS       T04919                                 

Gene name
herc2
Definition
(RefSeq) E3 ubiquitin-protein ligase HERC2 isoform X1
  KO
K10595  E3 ubiquitin-protein ligase HERC2 [EC:2.3.2.26]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108933171 (herc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sfm04121]
    108933171 (herc2)
   03036 Chromosome and associated proteins [BR:sfm03036]
    108933171 (herc2)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108933171 (herc2)
Enzymes [BR:sfm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     108933171 (herc2)
Ubiquitin system [BR:sfm04121]
 Ubiquitin ligases (E3)
  HECT type E3
   108933171 (herc2)
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    108933171 (herc2)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Ubiquitin ligases
     108933171 (herc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RCC1 RCC1_2 HECT Cul7 MIB_HERC2 Cyt-b5 ZZ ANAPC10 SH3_15 zf-UBR
Motif
Other DBs
NCBI-GeneID: 108933171
NCBI-ProteinID: XP_018605548
UniProt: A0A1W4ZXA8
LinkDB All DBs
Position
1
AA seq 4842 aa AA seqDB search
MPSPSFSLDAQLRFHNKWLKIDLQRAFSPEGLSEMWNEMVKDEEITCNGEESVHPEDCAD
CFGGQKKDDSNDKEEEEVSKSVHHSIIETWDWGRQPDECELRDCLRVLVEDQQKLAAHMA
KSALSAQRLRQRLVILERYLISLSHSMMEERYKVRWKSPPSPPQPATDNKSPRPAGKGVE
GLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEASLFDEGTVSPVW
LEVVERATKFLSDVHGSTSAKGPGTIPLQDQHLALAILLELAVQRGTLSQLLSAVLLLLR
LWDSGTQETDNERSAQGTCAPLLPLLHRFQNIHCSKDLPGAEEEEMEILAAPLSPNESFL
RYLTLPQDNNLAIDLRQTAVVIMAHLDRLAAPFSPPQCSSPTSHKEEHGNLQGTLQEVIG
WGLLGWKPHANVNGPVQCKALANLGVMQIVCSEKGFLILSRSGAVYTQSYKSTALAPALV
QALSSRKIVKVAAHPDGQHYLALSANGEVFSWGCGDGGRLGHGDTTYLEEPALITAFTGK
QTGKHVVHIACGSTYSAAITADGELYTWGRGNYGRLGHGSSEDQTTPMLVTGLKGLKVID
VACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLVEKLQDLDIMKVCCGSQ
FSVALTKEGQVYTWGKGDNQRLGHGTDEHVRYPKLLDSLQGKKVVDIAVGSTHCLALTDE
GEVHSWGSNDKLQHFDTLFSNKKQPKALPGLNSKHIVGIACGPGQNFAWSSCSEWSVGLR
VPFVVDVCPMTFEQLDLLLRQVSEGMDGSSDWPPPQEKECMVVATLSLLRLQLHSAISNQ
VDPEELGLGPGSMLLGSLKQAVVTLASNAGVLGTVQAAAQAVLQSGWSVLLPTAEERARA
LSSLLPSAVSGNEMGVGPGRRFMIDLLVSSLMADGGLESALNAAITAEIQDIEAKKEAQK
EKEIDEQEANASTLNRSRTPLDKDLINTGIYESTGKQILPLVQLVQQLLRNIASQTIARL
KDVARRISSCLDSEHVTRERSASLDLLLRFQRLLVSKLYMGVNRTEVVSSYNPELLGVGS
LLKKYIALLCTHIGDILPVATSIACTGHRHFAEVSRVIEGDLTGILLPELVVSIVLLLTI
DAGLMQETGSIPLLASLLEHLDRFNHLAPGHERDDNEDMAWPGIMGSFFTIQSSRSNEEV
SLIRKADLENHNKDGGFWTVIDGKVYDIKDFQAQSLTGNSILAQFAGEDPVIALEAALQF
EDTRESMQAFCVGQYMEPNQETVTTPDLSSLSSPLIDTERNLGLLLGLHASYLAMSTPLS
PMEIECGKWLQSSIFSGGLQTSQIHYNYNEEKDEDHCSSPGTTAPDKSRLYSRRMTLSDH
SQPFLQAIADNNIQDHTVKDFLCQIERCCKQYHLITPIIFPPEHPVEEVGRLLLCCLLKH
QDLGHVALSLVNQCALGVDQGKQRSLPKSVIDVCRMVYQAKCSLIKTHQEQGRSYKEVCA
PVVERLRFLFNELRPAASSDLSTVSKLKLLSSQPRWKMITQKLIRDRRRKRVPKKSDSAD
VEEVKLENDEAGAEEPSGIPSSPSLSDKKPLPMKPPKQDKWQPLLSTVTNVHKYRWLKHS
VQGPSPQPSLMATIVEFALKEEPLDVEKMRKCLLKQLERAEVRLEGIDTMLKLASKSFLL
PSVQYAMLCGWQRLIPEGTNIGEPLTDCLKYVDLIPPFNRMLLEVTFGKLYAWAIQNVRS
ILLDATVRFKELGVQPVPLQTITNENPAGPSLGTIPQARFLLVMLNMLSLKHSANSLSLL
LNSGMLALTQSILRLIGPSTDSTEEDPGLASHGGSATVLEESRKEAAPTPLPATGPELAA
MMKIGTRVMRGPDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTSSTNSYRMGKEGKYD
LKLAEPPPAIQTATEDSDTEDDAEGEPVEKSSHPTALMLTSTVNLLKTLALSAGIHAEVM
QMEAMRTLCGLLRMVVDSGTSDKTGCSAHRQVLLEQHRSWCTLGFIRSIALMPQMCSTLS
TSPWIALLIRIVEGHQSFTAITLQRQILALRLLQAVLPSWDRTERSQDMKFLVEKLFGFL
GSLLSTCSSDLPLLREGSLRRRKSRPQASLTATHSSTLAEEIVAVLRTLHSLSQWNGLIN
EYINSQLGCIGNIMAGRHSEATLLEEYFPDTDGPMAGSLMAVLAVIGGIDGRLRLGGQVV
HEEYGEGTVTRITPKGRITVQFHEMRTSRVCLLSQLKPLPVVSFSVNNLPFTEPMLGVWA
QLVHLAGSKQEKQRLKKPLNHGLADQVDLHLLRCQQLRLYILKAARALLSHQDKLRQILS
QPAILEAGPSPGDDSVISSLDVGDLSPEGPLPPLILLQQLLSAATQPSPIKAIFDKQELE
AAALAVCQYLAVESTHPSSPLFEDSSSSEATTPIAVQHMRPPRQKKRKASPIPPLPIVVQ
LMEMGFQRKNIEFALKSLSGTTGSASGVPGVEALVGWLLDHPDVHITELSDADTVSDEYS
DEDVVEELEEPEAAFPVPPGAVVTESQTFKKRSDFQSNDDYAVYVRENIQVGMMVRCCRT
YEEVYEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHTELLGFPPQSSPSHIKIG
DKVRVKLSVTTPKYKWGSVTHRSVGVVKAFSANGKDVIVDFPQQSHWTGLLSEMELVPSI
HPGVRCDGCQMFPINGPRFKCRNCDDFDFCESCFKTRKHSARHSFGRINEPGQPPTFCGR
SGKQLKRRHSSQRGVLIDEWSRVIKSLNVSSSVNQASRLIDCSEQCWQSSGSQGKHWIRL
ELFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPTDTTVALLNDCT
EYHRYIEIAIKQCRSSGIDCKIHGLSIVGRIRADDEDLATVPFLASDNEEDDDDKASTGS
LVRKKSAGLESAAAIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGGSK
SLFAVTAEGKVYACGEATNGRLGLGLSSGTIPIPRQITALGNYVVKKVAVHSGGRHAMAL
TVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAAITSSGELYS
WGLGEYGRLGHGDNTTQLRPKLVKVLLGHRVVQVACGSRDAQTLALTDEGLVFSWGDGDF
GKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGTD
VHVRKPQMVEGLRGKKIVHVAVGALHCLAVTDTGQVYAWGDNDHGQQGNGTTTVNRKPTL
VQGLEGQKITRVACGSSHSVAWTTVDVTTPSVHEPVLFQTARDSLGASYLGVQSDSDSSS
TSNKMSGQSSVKPNRPSLAKILLSLDGNLAKQQALSHVLSALQIMYARDAVVGALMPASM
ILPVECPSSSPIPPSDSSTASSPYEVDRPPVTAEAEECQSPNPWQDKRGEVTSSEDAMTP
TSAVTPSAAAASSRPFIPVTDDPGAASIIAETMTKTKEDSESQSKATGPEPQYLDEFTSL
LVPDDTRVLVDLLKLAVSMRAGEKGREVLSAVLSGMGTAYPQQVADVLLELCVTELEDVA
TDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHDPLTIMD
GANRIVSVRSGREWSDWSSELRIPGDELKWKFTSDGSVNGWGWRFTVYPIMPAAGTSHKP
FCPKDLLSDRCILSCPSMDLVTCLLDFRLNLASNRSIVPRLAASLAACAQLSALAAGHRM
WALQRLRKLLTTEFGQSININRLLGDGDGEARSMSFTGSALAALVKGLPEALQRQYEYED
PIVRGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCTASRVAVALDKRTP
LPRPFLDEVAKKIRELMADHENMNTLHECHDLFKREQDEHLVQWMNRRPDDWTLSAGGSG
TIYGWGHNHRGQLGGIEGAKVKVPTPTEALAMLRPVQLIGGEQTLFAVTADGKLYATGYG
AGGRLGIGGTESVSTPTLLESIQHVFIRKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLG
HGNRSPCDRPRVIESLRGVEVVDIAAGGAHSACITASGELYTWGKGRYGRLGHGDSEDQL
KPKLVDALQGHRVIDVACGSGDAQTLCLTDDDMVWSWGDGDYGKLGRGGSDGCKVPMKID
SLTGLGVVKVECGSQFSVALTKSGSVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVT
AIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKINRVACGSAH
TLAWSTSKPANAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHISELFCPCMPMFDLEGR
LGQTGQGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKG
GLAGPDGTKSVFGQMCAKMSSFSLDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEMCEE
LQNGLTPLLIVTPNGRDESGANRDCFLLNPAAKSPLHINMFRFLGVLLGIAIRSGSPLSL
NLAEPVWKQLAGMNLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMTLPFTVPSASGQD
IQLSSKYSHITLENRTEYVRLAINYRLHEFDEQVSAVREGMARVVPVPLLSLFTGYELET
MVCGSPDIPLHLLKSVATYKGVEPTVPLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRT
IADFRGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSID
TDDYARIALTGEPAADDSSEDSDNEDADSFASDSTQDYLTGH
NT seq 14529 nt NT seq  +upstreamnt  +downstreamnt
atgccttctccatccttctccctggacgcccagctgaggtttcacaacaaatggctgaag
atagacctgcagcgtgcattctccccagagggcctaagtgagatgtggaacgagatggta
aaagatgaggagatcacgtgtaatggggaagaatcagtacatccagaagactgtgcagat
tgctttggtggtcagaagaaggatgactctaatgacaaggaggaagaggaggtgtcaaag
tcagttcatcactctatcatcgagacgtgggattgggggagacaaccagatgagtgtgag
ctgcgggactgcctgcgggtgctagtggaggaccagcagaaactggctgcacacatggcc
aagagtgcactttcagcccagcgcctacgtcaacggctcgtcatcctggagcgctacctc
atatccctgagccacagcatgatggaagagaggtataaggtccgctggaagagccctcct
agccccccgcaacctgctactgataacaagagccctcgtccagctggaaagggtgtggag
ggccttgcaagggtgggctctagggccgcactttcctttgcctttgcctttctgcgcaga
gcctggcgatcaggcgaagatgcagacctgtgcagcgagcttcttcaggagtccctggat
gccttgcgagctctcccagaagcctctttgtttgatgagggcactgtgtcacctgtgtgg
ctggaggtggttgagcgggcaacaaagtttctcagtgatgtccatgggagcaccagtgct
aaaggcccaggcaccatcccgttgcaggaccagcatctggccctggccatcctcctggag
ctggctgtacagcgggggaccctcagccagcttctgtctgctgtcctgctgctcctccgt
ctgtgggacagcggcacgcaggagactgacaacgaacgctccgcccagggcacctgtgcc
ccactgcttcccctgctgcaccgcttccagaacattcactgcagtaaagacctgccaggt
gcagaggaagaggagatggagatcctagcagccccactgagcccaaatgaaagctttctg
cgctacctgacattgccccaggacaacaatctggccatcgacctgcggcaaactgcagtg
gtcattatggcacacctggatcggctggcggctcccttcagccccccacagtgcagctct
cccacctcacacaaggaggagcatggcaacctgcagggcacccttcaagaggtgattggg
tggggacttttgggttggaagccccacgccaatgtgaatgggcctgtccagtgcaaggcg
cttgccaacctgggggtcatgcagatcgtgtgctctgagaagggcttcctcattctgtct
cgcagtggagctgtctacactcagagctataagagtaccgcattggctccggcactagtt
caggccctgagctccaggaagattgtgaaggttgcagcccatccagacgggcagcactat
ctggctctgtcagccaacggggaggtcttctcctggggctgcggggatggtgggcggctt
ggccacggagacaccacgtacctggaagagccagctttgattacagcgttcactggaaaa
caaacaggaaagcatgtggtacacatcgcctgtgggagcacctacagtgcagccatcact
gccgatggggagctctacacctggggcaggggcaattatggcagactggggcatggctct
agcgaagatcagacaacaccaatgctggtgacgggactgaaaggactgaaggtcattgac
gtggcttgtggcagtggtgatgcacagaccctggctgtcacagagaatggtcaagtgtgg
tcctggggagatggtgactatggaaagctgggccgtgggggcagcgatggctgcaagaca
ccaaagctagtggagaagctacaggacctggacatcatgaaggtgtgctgtggaagccaa
ttctcagtggccttgaccaaagagggccaggtgtacacctggggcaagggtgacaaccag
cggctgggacatggcacagatgaacacgttcgctaccccaagctgctggacagtttgcag
ggaaagaaggtggttgacattgcagtaggctctacacactgcctggctctcacagatgag
ggagaggtgcacagctggggcagcaatgacaagctccaacactttgacactctcttctcc
aataagaagcagcccaaggcactgccaggcctcaactccaagcacattgtgggcattgcc
tgtggtcctggtcagaactttgcctggtcctcctgctcagagtggtcagtgggactgcgc
gtaccctttgtggtcgacgtctgccctatgaccttcgagcaactcgacttgctgctgcga
caggtcagcgagggcatggacggcagctcagattggccacccccacaggagaaggagtgc
atggttgtggccacactaagcctactgcggcttcagctgcactctgccatcagcaaccaa
gtagacccggaggagctggggctgggcccgggcagtatgctgctgggcagcctgaagcag
gctgtggtgacgctggccagcaacgcaggtgtgctgggcaccgtgcaggccgctgctcag
gctgtcttgcagagcggctggtccgtgctgctgcccaccgctgaagagagggcccgtgca
ctatcctcgctgcttcccagtgcagtgtctggcaatgagatgggtgttggtcctggccgg
cgcttcatgatcgatctcctggtgagcagcctgatggctgatgggggtttggagtctgcg
ctcaatgctgccatcactgcggagatacaggacattgaggccaaaaaagaggctcagaag
gagaaggagattgacgaacaggaggcaaatgcatccacgctgaatcggagcaggacaccc
ctggacaaagacctcattaacactgggatctacgagtccacagggaaacagatcctgcct
ctcgtacagctggtccaacaactactaaggaacattgcttctcagaccattgcacggcta
aaggatgtagcccgtcgcatctccagctgcttggactcggagcacgttaccagagagcgt
tcggcttcgcttgatctgctgctccgcttccagaggctgctggtcagcaaactctacatg
ggtgtcaacaggactgaggttgtcagcagctacaacccagagctgctaggtgtggggtcc
ctgttgaagaaatatattgcattgctctgcactcacattggggatatcctccctgtggcc
accagcattgcttgcactggccaccgccattttgctgaggtgtcccgtgtcattgaaggc
gatctcacaggcatcctccttcccgaactggttgtctccatcgtgttgctgctcaccatt
gatgccggcctcatgcaggagacgggctccatccccctcctagctagcctacttgagcac
ctagaccgcttcaatcatctggcacctggccacgaaagggacgacaacgaggatatggct
tggcctggcatcatgggatcatttttcacaattcagagctccaggagcaatgaagaggtt
tccctcatccgcaaggctgacctggagaatcacaacaaggatggtggattctggacagtt
atcgatgggaaggtctatgacatcaaggacttccaggcgcaatcccttactggaaacagc
atccttgcccagtttgctggagaagatccagtcattgcactagaagctgcactgcagttt
gaggacaccagggagtccatgcaggccttttgtgttggccagtacatggagccgaaccag
gagactgtgaccacaccagacctgagcagtctgtcttcaccccttattgacacagagaga
aatctgggcctccttctgggcctccatgcttcctacctggccatgagcacaccactgtca
cccatggagatagagtgtggcaagtggctccagtcgtctattttttctgggggcctgcag
accagccaaattcattacaactacaatgaggagaaggatgaggaccactgcagctctcca
gggaccacagcacctgacaagtcccgcctttattcccgccggatgacacttagtgaccac
tctcagcccttcctgcaggcaattgctgacaacaacatccaagatcacactgtgaaggac
ttcctgtgccaaattgagcgctgctgcaagcagtaccatctcatcacacccatcattttc
cctccagagcacccagtggaagaagtggggcggctgttgctctgttgcctgctcaaacac
caggatctgggtcacgtggccctgtcactcgtcaatcagtgtgccttgggtgtggaccag
ggcaagcagaggtccctcccaaaatctgtgattgatgtgtgtcgcatggtgtaccaggca
aagtgctctttaattaagacacaccaagaacagggccgctcctacaaagaggtttgtgcg
ccagtggtggagcgcttgcgcttcctgtttaatgagttgcggccagcggctagcagtgat
ctgtccaccgtgtccaaactgaagctgctgagctcacagccccgctggaagatgatcacg
cagaagctgattcgtgaccgccggagaaagagagttcccaagaagtctgactcagctgat
gtggaggaggtcaagctcgagaacgatgaggcaggtgcagaggaaccctcaggaatcccc
agcagcccctcgctttcagacaaaaagccactgcctatgaaaccccctaagcaggacaag
tggcagcctctgctgagcacagtgaccaatgtgcacaagtacaggtggctgaaacacagt
gtacaaggcccttccccacagcccagcctcatggccaccatcgtggagtttgcgctcaag
gaggagccgctggacgtggagaagatgaggaagtgcctcctgaagcagctggagcgagca
gaggtgagactcgaaggcatcgataccatgctgaaactggcatctaagagctttctgctg
ccatcagtgcagtatgccatgctgtgtggttggcagagactcattccagaagggaccaat
attggggaaccactgactgactgccttaagtatgtggatctcattcctcccttcaaccgc
atgctgctggaggttaccttcggcaagctgtacgcctgggccattcagaatgtgcgcagt
atcctgctggatgccactgtcaggtttaaagagcttggtgtacagccggtgcctctgcag
accattacaaatgagaatccagcaggaccaagtctcggaaccattccacaagcgcgcttc
ttgctggtcatgcttaacatgctgtccctcaagcatagtgccaacagcctcagcctgctg
cttaactcggggatgctggcgctcactcagagcatcctcagactcattggtccaagcaca
gacagcactgaagaggaccctggtttggcttctcatgggggctcagccactgtgctggag
gagtcgcggaaggaggcagcacccacccctcttccagccacaggtccagaactagcggcc
atgatgaagattggtacccgggtgatgaggggcccggactggaagtggggcgatcaggat
ggcccaccaccaggcctggggcgtgtgattggagagctgggtgaggatggctggatccgg
gtgcagtgggacactagcagtaccaactcgtatagaatgggcaaggaggggaagtatgac
ctcaaactagcagaacctccaccagccatccagacggccacagaggactctgacacagaa
gatgatgctgaaggagagccagtggaaaagagctcacaccccactgccctaatgctgacc
tctacggtaaacttgctaaaaacattggcattgtctgctggaatccatgcggaggtgatg
cagatggaggcaatgcgcacactctgtggcttgctcagaatggtggtagacagtgggacc
agtgacaagacaggctgttctgcccatcgtcaggtgttgctggaacagcatcgcagctgg
tgtacactgggcttcatacgcagtattgccctcatgccccagatgtgcagcacattgagc
acctcaccctggattgccctcctcatccgtatcgtggagggccatcagtccttcactgcc
atcactctgcagaggcagatcctggcactgcgcctgctgcaggcggtactcccatcctgg
gacaggacagagcgctctcaggacatgaagttcttggttgagaagctgtttgggttcctg
ggtagcctactgagcacctgctcctctgacctgcctcttctgagagaaggctccctgcga
cgcaggaagtctcgaccccaggcctccctgacggccactcacagcagcacgctggcggag
gagatagttgctgtgctgcgtaccctgcactctctgagccagtggaacggcctcatcaac
gagtacatcaactcgcagctaggctgcatcggcaacatcatggcaggccgacactccgag
gcgaccctgctggaggaatacttccctgacaccgatggaccaatggccgggagcttgatg
gcagtgctcgccgtgattgggggcatcgatgggcgcctgcggctaggcggccaggttgtg
cacgaggaatatggcgaaggcacagtgacacggatcacgccaaagggtcgcatcactgtg
cagttccacgagatgaggacctcccgggtgtgccttctcagccagcttaagccgttacca
gtggtgtccttcagtgtgaataacctccccttcacagagcccatgctgggtgtgtgggct
cagctggtccacctggcaggcagtaaacaggagaagcagcgtctgaaaaagccactgaac
cacggactcgctgaccaggttgacctgcacttgctgcgctgccagcagctacggctctac
atcctgaaggcagcacgagccctgctttcacaccaggacaagttgcgacagattctttcc
cagcctgcaatcctggaagctggacccagcccaggggatgatagtgtcatatcatcgctg
gatgtgggggatctgtccccagaaggtcccctgcctcccctcatcctgctgcagcagctg
ctctcagctgccacacagccctccccaatcaaggccatctttgacaagcaggaactggag
gctgctgccttggcggtgtgccagtacctggcggtggagtccacccacccttcgtcccct
ttgtttgaggacagcagctccagtgaggcgaccacccccattgctgtgcagcacatgcgg
cctccaaggcagaagaagcgcaaggcctcgcccattccaccactgcccattgtggtgcag
ctgatggagatgggttttcagaggaagaacattgagtttgcactcaaatcactgtcaggg
accaccggtagtgcctctggggtaccaggagtggaggcgctggtgggctggctcctggac
caccctgatgttcatatcacggagctctccgatgctgacactgtgtctgatgaatattct
gatgaagatgtggtggaggagctggaggagcctgaggcagccttccctgtgcctcctggt
gcagtggttacagaaagtcagacattcaagaagagatctgatttccagagcaatgatgat
tatgctgtttatgttcgggaaaacattcaggtgggaatgatggtaaggtgctgtagaacg
tatgaggaagtgtacgagggtgatgttggcaaagtgattaagctggaccgggatggactc
cacgatctgaacgtgcagtgtgattggcagcagaaaggcgggacgtactgggtgcgctac
atccacacagagctccttggattcccaccgcaaagctctccttcgcacatcaagattgga
gacaaggttcgagtgaaactttctgtaacgacgccaaagtacaagtggggctcggtcacg
cacaggagtgtcggtgttgtaaaagctttcagtgccaatggaaaggatgtgatcgttgac
ttccctcagcagtcccactggacgggcctgctgtctgagatggagcttgtgcccagtatc
catcctggagtcagatgcgatggctgccagatgtttccaatcaatggccccagattcaag
tgcaggaactgtgatgactttgacttctgtgagagctgcttcaaaactcgcaagcacagt
gctaggcactccttcggcaggatcaacgagccaggccaacccccaacgttctgcggacgt
tccgggaaacagttgaagagacgccacagcagccagcgcggtgtgctcattgacgagtgg
tcacgtgtcattaagagcctcaatgtgtcgtcatccgtcaaccaggcatcacgacttatt
gactgcagtgagcagtgctggcagtcctcagggtcgcagggcaagcactggatacgattg
gaactttttccagacgttctggtccacagattgaagatgattgtggatcctgcagacagc
agctacatgccttcccttgtagtggtgtcaggcggcaattctctcaacaaccttatagag
ctgaagacaatcaacattaaccccactgacactacagttgccctgctaaatgattgtact
gagtatcacaggtacattgagatagccataaagcagtgccgcagttcaggcattgattgc
aagattcatgggctcagcatcgtgggccgaatccgggccgacgatgaagacctggccact
gtccccttcctggcttccgacaatgaggaggatgatgatgataaagccagcactggaagt
ctggtccggaagaaatccgctggtcttgagtcagctgcagccatcaggactaaagtattt
gtgtggggtctgaatgacaaagaccagctggggggactgaagggttcgaagatcaaggtg
ccttcgttttctgagaccctttctgccctcaacgtagtacaggtagcaggtggttctaag
agcctgtttgcagtgacagcagaggggaaagtgtatgcttgcggagaagccacaaacggg
cgacttggcctaggcctctcaagcggtaccatccccatcccgaggcagatcacagccctt
ggcaactatgtggtgaagaaggtagcagtgcactcaggtggacgccatgctatggccctg
accgtggatgggaaggtcttctcctggggcgagggtgatgacggcaaactcggccatttc
agcagaatgaactgcgacaagccacgactcattgaggccctgaagactaagcggatccgg
gacatagcctgcgggagctcccacagtgcagccataacctccagtggggagctctacagt
tggggcctgggagagtatgggaggctgggccatggggacaacactacacagctccgacca
aaactggtgaaggtgcttctcggccatcgtgttgtgcaggtagcctgtgggagtcgggat
gcgcagactctggccctgaccgatgaaggccttgtattctcctggggggatggggacttt
ggcaaactagggcgcggaggcagcgagggctgcaacatcccccaaaatatcgagagactc
aatgggcagggcgtgtgtcagattgagtgtggggcccaattctccctggctctcacaaag
tctggtgttgtctggacctggggaaagggggactacttccggcttggccacggcactgac
gtccatgtgcgcaaaccccagatggtggagggtctaagggggaagaagattgtccatgtg
gccgttggggcactgcactgcctggccgtcactgacactggacaagtgtatgcatggggt
gacaacgaccatggacagcagggaaacggcactaccacggtgaatcgaaagcccactctg
gtgcagggcttggagggccagaagatcacccgtgtggcctgtggctcttcacacagtgtg
gcctggaccactgtggatgtgaccacaccctcagtgcatgagccagtgctgtttcagacg
gcaagggactccctgggtgcatcttacttgggagtccagtcagacagtgactcatccagt
accagtaacaagatgagtggccagagcagcgtgaaacccaatcgaccatccctggccaag
atcctgctttcactggatggtaacctggccaaacagcaggccttgtcccacgttctctct
gccctgcagatcatgtacgcaagggatgcagtggtaggggctctcatgcctgcctccatg
attctgccagtggagtgtccctccagctcacccatcccaccttctgactcatctacggcc
tccagcccctatgaggtagaccgccccccagtgactgcagaggcagaggagtgccaaagc
cctaacccctggcaggacaagaggggggaggtgacctcttcagaggatgccatgactccg
acatctgcggtaaccccctccgcagcagcagcctcctctcgccccttcattccagtgacc
gatgaccctggtgctgccagcatcattgcagagacaatgaccaaaaccaaagaggactca
gagagccagagcaaggccaccgggcctgaaccccagtacctggatgagttcaccagcctg
ttggtgccagatgatacgcgtgtcttggtggacttgctcaagctggccgtgtctatgcgt
gcgggggagaagggtcgggaggtgctgtctgcagttctgtctggcatgggcacagcctac
ccacagcaggtagctgacgtgctcttggagttatgtgtgacggaactggaagatgttgcc
acggactcacagagcgggcgtctgtcatcccagcctgtggttgtggagagtagccacccc
tatacggacgacacatccaccagtggcacggtcaagatcccaggtgctgaaggactgagg
gtggaatttgaccgacagtgctccactgagagacggcacgacccgctcacaatcatggat
ggggccaataggattgtatctgtccgatcaggtcgggagtggtctgactggtccagtgaa
ctccgaatcccgggtgatgaactcaagtggaagttcaccagcgatggctctgtcaatggc
tggggttggcggttcacggtgtatcccatcatgcctgcagctggtacatcccataagcca
ttctgtcccaaagacctgctgtcagaccgttgcatcctctcttgcccatcaatggacctg
gtaacctgcctgctggacttccggctcaacctggcctccaacaggagtattgtgccacgg
ctggctgcttcactagcagcctgcgctcagctgagtgccttggcggccggccaccgcatg
tgggctctgcagaggttacgtaaactgctcaccacagagtttggccagtccatcaacatc
aacaggctgcttggagacggtgatggcgaggcacgctctatgagtttcaccggcagcgca
ctggcagcactggtgaaggggcttcctgaggccctccagaggcaatacgaatatgaggat
cccattgtgagagggggcaagcagctgctccatagcccttttttcaaggttcttgttgca
ttggcctgtgacctggaactagacacactaccttgctgtgcagaaacccacaaatgggcc
tggttccgcagatactgcactgcctctagggtagccgtggctttggacaagaggaccccc
cttccacgcccgtttctcgacgaggtggccaagaaaatccgtgagcttatggcggaccat
gagaacatgaacactcttcacgagtgccacgatctgttcaagagggagcaggatgagcat
cttgtccagtggatgaataggcgacctgacgactggacgctctctgctggcggaagcggt
accatctatggctggggacataatcaccgaggccaactgggaggcattgagggggccaaa
gtgaaggtgcctaccccgactgaagcgcttgccatgctccgccctgtgcagcttattggt
ggggagcaaactctgtttgccgtgacagccgacggcaagctatacgctacgggctatgga
gctgggggccgcctcggcattgggggcacagaatctgtgtccacacccacactgctggag
tccatccagcatgttttcattcgcaaggtggcagtgaactctggtggcaagcactgcctt
gcgctgtcctcagagggagaagtctactcctggggggaggctgaagatggaaaacttggc
catggcaataggagtccatgcgatcgaccacgagtgattgaatccctgcgtggtgtggag
gtggtggacattgcagccggtggtgcacacagtgcctgcatcactgccagtggcgagctc
tacacttggggcaagggtcgctacggccgcctgggccatggggacagtgaagatcagctc
aagcccaaactggtggatgcgctgcagggtcaccgcgttatcgacgtggcctgtggcagt
ggtgatgcccagacgctgtgcctgacagatgacgacatggtgtggtcgtggggggacggt
gactatggcaaactgggccgtggaggcagcgatggttgtaaggtgcccatgaagatcgat
tctctcacgggcctgggtgtggtcaaggtggagtgcggttcccagttctctgtggctctg
acgaaatctggctctgtctacacctgggggaaaggagactaccaccgactgggccacggc
tctgacgaccatgtacgccggccgcgacaggtgcagggcttgcagggcaagaaggtgact
gccattgccacagggtccctgcactgtgtctgctgcactgaggacggggaggtctacacc
tggggagacaacgatgaaggccagctgggggacggcaccaccaatgccatccagaggcca
cggctggtggcggctctacaagggaagaagatcaacagggttgcctgtggctccgctcat
actcttgcttggtctaccagcaagcctgccaatgcgggaaagctgcctgctcaggttcca
atggagtacaaccacctgcaggagatccccatcatcgccctgcgcaatcggctcctcctg
ttgcaccatatctcggagcttttctgcccctgcatgcctatgttcgacctggagggtcgg
ctgggccagacaggccagggcccctcggtcggatttgatacacttagaggcatcctcatt
tcacagggcaaggaagcagcatttcgcaaggttgtccaggccaccatggttcgagacaga
caacatggacctgtggtggagctgaacaggatccaggtgaagcgttcaaggagcaagggt
ggcttggcagggcctgatggcaccaagtctgttttcggccagatgtgtgccaagatgagc
tccttcagccttgacagtttgctgttgccgcaccgcgtctggaaggtcaagtttgttgga
gaatctgttgacgactgtggtggtggctatagcgagtccatcgctgagatgtgcgaggag
ctgcagaatggcctcacgccgttgctcatcgtgacgcccaacggccgcgacgaatcaggc
gccaaccgtgactgctttctgctcaaccctgctgctaaatcacccttgcacatcaacatg
tttcgtttcctaggtgtcctcctgggcattgccattcgtagtggcagcccgctgagcctg
aaccttgctgaacctgtttggaagcagctggcgggcatgaacctgaccattgctgacctc
agtgaggttgataaggacttcatcccaggcctgatgtatatccgggacaatgaagccacc
tccgaggagttcgaggccatgacgctgcccttcactgtccccagtgctagtggccaggac
atccagctcagctctaagtactcccacataaccctggagaaccgcaccgaatatgtgagg
ctggcaataaactacaggctccacgagtttgatgagcaggtatctgccgtgcgggaggga
atggcccgggtggttccagtgcccctcctgtccctcttcacgggctatgagcttgagacc
atggtatgcgggagcccggatattcccctgcacctcttgaaatcagtggctacctacaag
ggcgtggagccaacggtgcccctcatccagtggttctgggaggttatggagtccttctcc
aacacggagcgctctctgttcctgcgctttgtttggggacgcaccaggctgcccaggact
attgctgacttcagggggcgggattttgtcatacaggtgctggacaagtacaaccctcct
gaccactttctcccagaatcatacacctgcttctttctgctcaagctgcccaggtattca
tgcaaacaggtgctggaggagaagctcaagtacgccatccatttctgcaagtccattgat
acggacgactatgcacgcattgcactgactggcgagccggccgccgacgacagcagcgag
gactcggacaacgaggatgcagattcctttgcctccgattctacacaggactacttgacc
ggacactga

DBGET integrated database retrieval system