KEGG   Scleropages formosus (Asian bonytongue): 108933423
Entry
108933423         CDS       T04919                                 

Definition
(RefSeq) proliferating cell nuclear antigen-like
  KO
K04802  proliferating cell nuclear antigen
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03030  DNA replication
sfm03410  Base excision repair
sfm03420  Nucleotide excision repair
sfm03430  Mismatch repair
sfm04110  Cell cycle
sfm04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108933423
   03410 Base excision repair
    108933423
   03420 Nucleotide excision repair
    108933423
   03430 Mismatch repair
    108933423
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108933423
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108933423
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108933423
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108933423
DNA replication proteins [BR:sfm03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    108933423
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108933423
   MMR (mismatch excision repair)
    Other MMR factors
     108933423
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    108933423
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad1 Rad9 Hus1
Other DBs
NCBI-GeneID: 108933423
NCBI-ProteinID: XP_018605995
UniProt: A0A0P7UEP6
LinkDB
Position
6
AA seq 260 aa
MFEARLVQGAILKKVLEALKDLITEACWDVSSSGISLQSMDSSHVSLVQLTLRSDGFDSY
RCDRNLAMGVNLGSMSKILKCAGNDDIITLRAEDNADTLALVFETPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSQIGDAVMISCAKDGVKFSASGELGTGNV
KLSQTSNVDKEEEAVTIEMNEPVQLIFALNYLNFFTKATPLSKTVTLSMSADIPLVVEYK
IADMGHIKYYLAPKIDEESS
NT seq 783 nt   +upstreamnt  +downstreamnt
atgtttgaggcacgactggttcagggtgcgatcctgaagaaggttctggaggcactcaag
gacctcatcaccgaagcgtgctgggatgtcagctcgtccgggatctccctgcagagcatg
gactcgtcccatgtgtccttggtgcagctcaccctgcgcagcgatggcttcgactcctat
cggtgtgaccgaaacctcgctatgggggtcaacttgggcagcatgtccaagatcctgaag
tgtgcgggcaatgatgatatcatcactctgcgggcggaggacaacgctgatacactggca
ctcgtttttgagacaccgaaccaggaaaaggtgtctgactatgagatgaagctgatggac
ctggatgtagagcagcttggaattccggagcaagagtacagctgtgtggtaaagatgccc
tccggagagtttgcccgcatctgcagggacctgtctcagattggtgatgctgtcatgatc
tcatgtgcaaaggatggggtcaagttctctgcctctggggagctgggcactggtaacgtc
aagctttctcagaccagcaatgtggacaaagaggaagaagcggtgacaattgaaatgaat
gagcctgtgcagctcatctttgctctcaactacctgaacttcttcaccaaggctacgccc
ctctctaagacagtcacactcagcatgtctgctgatatccccttggtggtggagtacaag
attgcagacatgggtcacatcaagtattatctggctcctaagattgatgaagaatcctct
taa

KEGG   Scleropages formosus (Asian bonytongue): 108940373
Entry
108940373         CDS       T04919                                 

Definition
(RefSeq) proliferating cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03030  DNA replication
sfm03410  Base excision repair
sfm03420  Nucleotide excision repair
sfm03430  Mismatch repair
sfm04110  Cell cycle
sfm04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108940373
   03410 Base excision repair
    108940373
   03420 Nucleotide excision repair
    108940373
   03430 Mismatch repair
    108940373
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108940373
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108940373
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108940373
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108940373
DNA replication proteins [BR:sfm03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    108940373
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108940373
   MMR (mismatch excision repair)
    Other MMR factors
     108940373
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    108940373
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad1 Rad9 Hus1
Other DBs
NCBI-GeneID: 108940373
NCBI-ProteinID: XP_018618005
LinkDB
Position
12
AA seq 260 aa
MFEARLVQGSILKKVLEALKDLITEACWDVSSSGISLQSMDSSHVSLVQLTLRSDGFDSY
RCDRNLAMGVNLSSMSKILKCAGNEDIITLRAEDNADTLALIFETLNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSQIGDAVMISCAKDGVKFSATGELGTGNV
KLSQTSNVDKEDEAVTIEMNEPVQLIFALNYLNFFTKATPLSKTVILSMSADIPLVVEYK
IADMGHVKYYLAPKIDEEAS
NT seq 783 nt   +upstreamnt  +downstreamnt
atgtttgaggctcgcttggtccagggctccattctgaagaaggtgctagaggccctgaag
gacctgatcaccgaggcctgctgggacgtgagctcctcgggcatttccctgcagagcatg
gactcgtcccacgtgtccctcgtgcagctcactctgcgcagcgacggcttcgactcgtac
cgctgcgatcggaacctggccatgggggtcaacctgagcagcatgtcaaagatcctgaaa
tgtgccggaaacgaagacatcatcactctgcgagcggaggacaacgcggacacgctggcc
ctcattttcgagacactaaaccaggagaaagtgtctgactacgagatgaagttgatggac
ttggatgtggagcagttgggaatccctgagcaagagtacagctgcgtggtgaagatgccc
tcgggggagtttgcgcggatctgccgtgacctgtctcagatcggcgatgccgtcatgatc
tcctgcgctaaggatggggtcaagttctctgccactggggagctgggtactggaaacgtc
aagctgtcgcagaccagcaacgtggacaaggaggacgaagctgtcacaattgagatgaat
gaacctgttcagctcatcttcgccctcaactatctcaacttcttcaccaaggccacacct
ctatccaagacggttatcctcagcatgtctgcagatatcccactagtggtggagtacaag
attgcagacatgggacatgtgaaatactacctggcacccaaaattgatgaagaggcttcc
taa

DBGET integrated database retrieval system