KEGG   Scleropages formosus (Asian bonytongue): 108933539Help
Entry
108933539         CDS       T04919                                 

Definition
(RefSeq) neuroendocrine convertase 2-like isoform X1
  KO
K01360  proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sfm01002]
    108933539
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sfm03110]
    108933539
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     108933539
Peptidases [BR:sfm01002]
 Serine Peptidases
  Family S8: subtilisin family
   108933539
Chaperones and folding catalysts [BR:sfm03110]
 Intramolecular chaperones
  Subtilisin family
   108933539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 108933539
NCBI-ProteinID: XP_018606201
UniProt: A0A1W5A0C7
LinkDB All DBs
Position
Unknown
AA seq 640 aa AA seqDB search
MLASGTRCAASLFVLVHVVAALAGGAEEGIFTNHFLVQLHEGAGGDAHQVAAEHGFGGAR
KLPFGEGLFHFYPTDIHHTRRRRSLELQRRLEKDHRVKNVVQQQGFSRKKRGYRKIDDIE
TKLNDPLFTKQWYLVNTGQANGMPGLDLNVAEAWDLGFTGKGVTIAIMDDGIDYLHPDLV
SNYNADASFDFSSNDPYPYPRYTNNWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGI
RMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRG
GKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNG
RTRDPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDLQHLTVLTSK
RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGSMVKMAKEWKTVPERYHCIAGSVQESHK
ISSEGTVTLTITTDACQGKDNFVRYLEHVQAVVTVNSTRRGDLTINMTSPMGTRSILLSR
RPRDADAKVGFDKWPFMTTHTWGEDPRGSWVLEVGLVGDAPQEGVMREWTLMLHGTQSAP
YIDQVVRDYQSKLAMSKKQELEGELDEALDQSLQSLLSRN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcctctggcacgcgctgcgctgcttcgctcttcgtgctcgtgcacgtcgtcgca
gctctcgctggaggagcggaagagggcatttttacgaaccatttcttggtgcagctgcac
gaaggggcaggtggggacgcgcaccaagtggctgccgagcacggtttcggcggcgcgcgg
aagcttccttttggggagggacttttccacttttaccccacggacatccaccacaccagg
aggcgacgaagccttgagctccagcgacgactggagaaggatcatagggtgaaaaatgtt
gttcaacagcaaggatttagtcggaagaaaagaggctatcggaagattgatgatattgag
accaaattaaatgacccgctgtttactaaacagtggtatcttgtaaacacaggtcaagcg
aacggcatgcctggactggatctcaacgtagctgaagcgtgggatctaggattcacagga
aaaggagtaaccatagcaatcatggatgatggcatcgactatttacacccagatcttgta
tcaaattataatgccgatgccagctttgacttcagcagcaatgacccctatccgtacccc
cgctacaccaacaactggttcaacagccatggaacaagatgtgcaggcgaggtttctgca
gcagcaaacaacaacatctgtggtgtcggagttgcctacaattccaaggtggcaggcatt
cggatgctagaccagcctttcatgacagacattatagaggcctcatcaataagccatatg
ccacaagtcattgacatatacagtgcaagctgggggccaacggatgatgggaagaccgtg
gacggcccgcgcgagctgacattgcaggccatggcagacggtgtgaacaagggcagaggc
gggaaaggcagcatctatgtgtgggcctcaggagatggtggcagctatgatgactgcaac
tgcgatggctatgcctccagcatgtggaccatctcgatcaactcagcaatcaacgatggg
cgcacggcgctctacgatgagagctgctcgtccactctggcatccacgttcagcaatggc
cgcaccagggatcctgaagcaggagtggccaccaccgacctgtacgggaactgcacgcta
cgtcactcaggtacatccgcggcagctccagaggcggccggagtgttcgcattggcgctg
gaggccaaccctaatctgacttggagggacctgcaacacctgaccgtcctcacgtccaag
cgcaaccagctgcacgatgaagtgcaccagtggcgtcgcaatggtgtgggccttgagttt
aaccacctctttggttatggagtgctggatgctggcagcatggtcaagatggccaaagag
tggaagactgtgcctgagcgttaccactgcattgcgggatcagtccaggaatcacacaaa
atctcatctgaaggcacggtgaccctgaccatcaccacagatgcctgccaaggcaaagac
aattttgtgcgctacctggagcatgtgcaagcagttgtgacggtcaactccacccgtcgt
ggcgacctcaccatcaatatgacctcgcccatgggtacccgctccattctgttgagccgg
cggccccgcgatgctgatgccaaggtgggcttcgacaagtggcccttcatgaccacccac
acgtggggcgaggatccacgtggctcgtgggtgctggaggtaggcctggtgggagacgct
ccacaggagggagtcatgcgggagtggacactgatgctccatggcacgcagagcgccccc
tacatagatcaggtggtgcgtgattaccagtcgaaactggccatgtccaagaagcaagag
cttgagggggagctggacgaagccctggaccagagtctgcagagcctgctgagcagaaac
tag

DBGET integrated database retrieval system