KEGG   Scleropages formosus (Asian bonytongue): 108933581Help
Entry
108933581         CDS       T04919                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    108933581
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108933581
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108933581
Protein kinases [BR:sfm01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   108933581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal RIO1 Kdo FTA2 APH YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 108933581
NCBI-ProteinID: XP_029115130
LinkDB All DBs
Position
16
AA seq 397 aa AA seqDB search
MGRNDAHRLWRKRTDDIRNVFDFMEVLGSGAFSEVFMVREKKTGKQFALKCVKKQHLHAK
NLENEITVLRRIKHENIIGLEDFYESDTHYYLVMELVLGGELFDRLLDRGTYTEKDASHV
IRQVLQGVSYLHRNNIVHRDLKPENLLYYSQDENSKIMISDFGLSKIEDNGIMSTACGTP
GYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYEDNESKLFCKIIKAEYEFDSPFW
DDISASAKDFIRNMMQKNAKLRYTSEQALRHPWISGNTARSQDIYHSFRKQIQKNFAMCK
WRQAFNATVAISHLKKLQLAQSGPTNPRANVLLPDIQISDLSSPVIAGQRLNANLEHNGN
LTGSCESENDLMVNYVKYCRKVYKNEVRDTALAGQSF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtaacgatgctcaccgtctctggaggaagagaacagacgacattcgcaatgtg
ttcgacttcatggaggtgctgggatcgggtgccttctcagaggtgttcatggtgagggag
aagaaaacggggaagcagtttgcactcaagtgtgttaagaagcaacatctgcatgcaaag
aacttggaaaatgaaatcactgtgctgaggaggatcaaacatgaaaatatcatcggtctg
gaagatttctacgaaagcgacactcattattaccttgtcatggagctcgttttgggcggt
gagctgttcgaccggctcttggatcgtggaacatacacagaaaaagatgccagccatgtt
atccggcaggtgctccaaggtgtcagctacctgcacaggaacaacattgtccaccgtgac
ctgaagccggagaatctgttgtactacagccaggacgagaattcgaagatcatgattagt
gattttggtctctccaaaatagaggacaatggcattatgtctacagcttgtggcacacca
ggatatgtggcccctgaggtcctggctcagaaaccatacagcaaggctgtggactgttgg
tctattggagtcatcacttacatcttgctgtgtggatacccacctttctatgaagataat
gaaagcaagctcttttgcaaaattataaaagcggagtatgaatttgactcaccattctgg
gatgatatttctgcatccgcaaaggactttattcggaatatgatgcaaaagaacgctaaa
ctgcgctatacctcagagcaggcgctcagacatccctggataagtggaaacacagcaaga
agccaggatatctaccactccttcaggaagcagatccagaagaatttcgctatgtgcaag
tggaggcaagcctttaatgcaacagtggccatctcccacctgaagaagctgcagctggcc
caatctgggcccacaaaccccagagcgaacgtgctcttgccagatattcagattagtgac
ctgtcctcccctgttatagcaggccagcgactcaatgccaacttggaacataatggaaac
ctgacaggcagttgtgagagtgagaatgatctgatggtcaactatgttaaatactgcaga
aaggtctacaagaatgaggtgagggacactgccctagcaggtcagagcttctga

DBGET integrated database retrieval system