KEGG   Scleropages formosus (Asian bonytongue): 108933662
Entry
108933662         CDS       T04919                                 

Gene name
poll
Definition
(RefSeq) DNA polymerase lambda
  KO
K03512  DNA polymerase lambda [EC:2.7.7.7 4.2.99.-]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
sfm03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108933662 (poll)
   03450 Non-homologous end-joining
    108933662 (poll)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108933662 (poll)
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     108933662 (poll)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.-  
     108933662 (poll)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     108933662 (poll)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     108933662 (poll)
SSDB
Motif
Pfam: DNA_pol_B_palm DNA_pol_lambd_f DNA_pol_B_thumb HHH_8 BRCT_2 BRCT NTP_transf_2 LIG3_BRCT PTCB-BRCT
Other DBs
NCBI-GeneID: 108933662
NCBI-ProteinID: XP_018606371
LinkDB
Position
16
AA seq 584 aa
MNPEVFRFLNLCFFFFLNSRACVVLLLSKKEMALPGIVKAFPKVKRQSGDELEGKEGPPG
KKKSEDAVTGNFFKGVSVHILPAGIGNARCKIFEKQVSQNGGLVEPTFCPSVTHVILDDS
MDFDRALRLLKVERLPLSVQLVKSSWLSLCITEKTLLSTSNYSLPIPSSQVESFEGEAKE
DSCSEVPSCSLSKGIPPPPEAKEDDVLQQISGEREEDDVSQNDLDALIKGLNPKSEILPL
EQKPTLEKWVCAQSSLSKTENYNKHITDKLELLAKAYTHQGDKWRSLSYSKAVSALKSYH
KPITSFEEACKIQGIGKRMAEKIMEIMESGHLRKLDYIGEDVPVLELFTNIWGAGAKTAK
LWYQQGFRTLDDIRTKAQLTSQQKIGLKHYDDFLDRMPREEAAAIEKTVRDAAHSLNPGL
LAIACGSYRRGKATCGDVDVLITHPDGKSHRNVFSKILLNLHQHGFLTDDLVSNEENGEQ
KKYLGVCRLPGPGQRHRRLDIIVVPYNEFACALLYFTGSAYFNRSMRALAKTKKMSLSEH
SLNKDVMRQGSLKVSSGIPLSTPTENDVFTYLGIPYREPHERDW
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgaacccggaagttttccgttttttaaatctctgtttttttttttttttaaactcacgt
gcctgtgttgtgttgctgctctccaaaaaagagatggcactgcctggcattgtaaaagcc
ttcccaaaagtgaagagacagagtggagatgaacttgaagggaaagaagggcctccaggc
aaaaagaaaagcgaggatgcagtaacaggaaatttctttaaaggagtgtcagtacacata
ctcccagctggtattgggaatgcccgctgtaaaatatttgagaagcaggtctcccaaaat
ggtggactggttgagcctaccttctgtcccagtgtcactcatgtcattctggatgattcc
atggactttgatcgtgccttgcgcctgctgaaggtggagagacttcctttgtcagtgcag
ctggtaaagagttcctggcttagtctgtgcattacagagaagacattgctcagcacttca
aactacagcctccccatacctagcagtcaagtggaaagctttgaaggagaagcaaaagaa
gattcatgtagtgaagtcccaagctgctcactctcaaaaggaattccaccaccgcctgaa
gcaaaagaggatgatgtattgcaacaaatatcaggtgagagagaggaagatgatgtctca
caaaatgatcttgatgccctcatcaaagggctcaatcccaagagtgagatattgcccttg
gaacagaaacccactctagagaagtgggtttgtgctcagtcttctctctctaaaactgaa
aattataacaagcacatcacagacaagctggagctcttggccaaggcttacacacatcaa
ggggataagtggagatcacttagttactcaaaagctgtcagtgcacttaagagctaccac
aaacccattacttcatttgaggaggcttgtaagatccaaggtattgggaaacgaatggca
gaaaagatcatggaaatcatggagagtggccaccttcgcaagttggactacataggagag
gatgttccagtactagaactcttcaccaatatctggggtgctggtgccaagactgcaaag
ttgtggtatcaacagggctttcgcactttggatgatatccgcactaaggctcagctgacc
tcccagcaaaaaataggactgaagcattatgacgattttctagaccggatgccaagagaa
gaagctgctgctattgaaaaaacagtaagggatgctgcccactccctgaacccaggtctg
ctggccattgcatgtggctcgtaccgtagagggaaggcaacctgcggagatgtggatgtt
ctcattacacacccagatggaaaatcccacaggaatgtcttcagtaaaatactactaaac
ctgcatcagcatggctttctgacagatgacctcgtcagcaacgaggagaatggagaacaa
aagaagtatctgggtgtgtgccgtctaccgggccccgggcagcggcaccggagactggac
atcattgtagtgccatacaatgagtttgcctgcgcgctgctgtacttcactggatctgcc
tatttcaaccgttccatgagggccctggccaaaaccaagaaaatgagcctctcggaacac
tctctcaacaaagatgtgatgcgccagggcagcctgaaggtttcttctggaatcccactt
tccacaccaacagagaacgatgtctttacttaccttggtataccctacagggagccccat
gaaagggactggtga

DBGET integrated database retrieval system