KEGG   Scleropages formosus (Asian bonytongue): 108933769Help
Entry
108933769         CDS       T04919                                 

Gene name
mcm4
Definition
(RefSeq) DNA replication licensing factor MCM4
  KO
K02212  DNA replication licensing factor MCM4 [EC:3.6.4.12]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03030  DNA replication
sfm04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108933769 (mcm4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108933769 (mcm4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108933769 (mcm4)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     108933769 (mcm4)
DNA replication proteins [BR:sfm03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    108933769 (mcm4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N AAA_5 Mg_chelatase AAA_3 AAA Elf1
Motif
Other DBs
NCBI-GeneID: 108933769
NCBI-ProteinID: XP_018606580
UniProt: A0A1W5A084
LinkDB All DBs
Position
16
AA seq 861 aa AA seqDB search
MSSPSATPTKGKRTRGSNPPTPWSEDALTPPSRRRRTDDASTSDLQPMPTSPVTDMRSPA
VQDTSLFSSPAQSRHSAPLNEIDMSSPLTYGTPSSRVEGTPRSGLRGTPVRQRPDLGSVR
KARQVDLHSDHANGPEAPASEHSVGQKLVIWGTDVNVGTCKEKFQRFLQRFIDPSSTDDE
NAGLDLNEPLYMQKLEEINVVGDPVLNVNCEHLQSFDADLYRQLIAYPQEVIPTFDMAVN
ELFFERFPDSVIEHQIQVRPYNALKTRNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEA
FFRCQVCAFSTRVEVDRGRIAEPAVCRNCNTTHSMALIHNRSIFSDKQMIKLQESPEDMP
AGQTPHTTVVYAHNDLVDKVQPGDRVNITGIYRAVPIRLNPRQSNVKSVYKTHIDAIHFR
KTHEKRLHGLDEEAEEKLFTEERVRTLRELAAKPDVYERLSSALAPSIYEHEDIKKGILL
QLFGGTRKDFSQTGRGGFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVG
LTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDSTRSVLHEVMEQQTLSIAKAG
IICQLNARTSVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRL
AHHLVSLYYQSEEQLEEEFLDMAMLKDYVAYARSYIEPRLSEEASQALIKAYVDMRKIGS
GRGMVSAYPRQLESLIRLAEAHAKVRFSDKVETIDVEEAKRLHREALKQSATDPRTGFVD
ISILTTGMSATARKRKEELAQALKRLIQSKGKVPTMKYQQLFDDLRAQSDVAITKDMFEE
ALQALTDEDYLTVTGKTVRLL
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaccatctgcaactcccactaagggcaagcgcacccgaggcagtaatccacct
acgccttggagcgaggatgcgttgaccccgccctccaggcgccgcagaactgatgacgcc
tccaccagtgatctgcagcccatgccaacctctccggtcacagacatgcgcagtcctgca
gtccaggacacctctctcttttctagccccgcgcagtcacgtcattcagctcccctgaat
gagatagatatgagctcaccgttgacatatggcacccccagttcgagggtggagggtacc
cctcgcagtgggttgcgtgggaccccagtccgccagagacctgaccttggctcggtcaga
aaggcgcggcaggtggacctgcattcagaccacgccaatggtcctgaagcaccagctagt
gagcactctgtgggccagaagcttgtgatctggggcactgatgtcaacgtgggaacctgc
aaagagaagtttcagagattcctgcagcgcttcatcgaccccagctccacagatgatgag
aatgctggattggacctgaatgaacccctctatatgcagaaactggaggagatcaatgtt
gttggggatcctgtgctgaatgtcaactgtgaacacctgcagtcatttgatgcagatctg
tacaggcagctcatcgcctatccccaggaagttattcccacttttgacatggctgtgaac
gaactcttctttgagcgttttcccgattcagttatagaacatcagatccaagtgcgaccc
tataatgctctcaaaacgaggaacatgagaaaccttaaccccgaagatatcgatcagctg
attaccatcagtggtatggtgatccggacctcccagcttatcccagagatgcaggaggcg
tttttccggtgccaggtttgtgctttctccacgagggtggaagtggaccgcgggcgcatt
gcggaaccagctgtgtgccgcaactgtaacacgacccacagcatggctcttatacacaac
cgctccatcttctcagacaagcaaatgatcaagctgcaggagtcacctgaggacatgcct
gctggacagacgccacacaccacagtggtgtatgcccataatgacctggtcgacaaagta
cagcctggagaccgagtcaacatcacaggaatatacagggccgtgcccattcggctgaac
cctcggcagagcaatgtaaagtcggtctacaagacccacatagatgccatccacttccgc
aagacacatgagaaacggctgcatggcctggatgaggaggcagaggagaagctgttcaca
gaggagagagttcgcaccctgcgggagctggcagctaaacctgatgtctatgagcgactg
tcctctgcacttgcacccagcatctatgaacatgaggacatcaaaaagggtatcctgctg
cagctgtttggaggtacacggaaggactttagccagactggccgggggggcttccgggct
gagatcaacatcctcctatgtggtgaccctggtactagcaaatcccagttactgcagtat
gtctacaacctggtgccacgtggtcagtacacatcaggcaagggctccagtgcagtgggc
ttaactgcctacgtcatgaaggatcccgagacacggcagctggtcctgcagactggtgcc
ctggtgctcagcgacaatggcatctgctgcattgatgaatttgacaagatgagcgatagc
acacgctcggtgcttcatgaggtcatggagcagcagaccctctctattgctaaggctggg
atcatttgtcagcttaatgctcggacctctgttttggcagcagccaacccagtagagtct
cagtggaaccccaagaagaccaccattgagaacatccagctcccacatacactgctgtcc
agatttgatctcatcttcctgatgctggatccccaagatgaggcttatgaccgccgcctt
gcccaccatttggtgtctctgtattaccaaagtgaagagcagctggaggaggagttcttg
gacatggccatgctcaaagactatgtagcttacgctcgctcctacatagagccccgactg
agtgaagaagccagtcaggcactgatcaaggcttatgtggacatgaggaagattggcagc
gggcgaggcatggtctcagcctaccctcggcagctggagtctcttatcaggctcgcagaa
gctcatgccaaggtgcgcttctcggacaaggtggagaccatcgacgtggaggaggcaaaa
cgactgcaccgtgaagctttgaagcagtcggccactgaccccaggactggatttgtggac
atatccattctgacaacaggaatgagtgccacagcccgaaagcgcaaagaggagctcgca
caggccctgaaacggctgatacagtccaaagggaaagtccccactatgaagtaccagcag
ctttttgatgatcttcgtgcacagtctgatgttgctataacaaaggacatgtttgaggag
gccctgcaagccctgacagatgaggactacctgacagtcacgggaaagacagtgcgcttg
ctgtag

DBGET integrated database retrieval system