KEGG   Scleropages formosus (Asian bonytongue): 108933822
Entry
108933822         CDS       T04919                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
sfm  Scleropages formosus (Asian bonytongue)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1
Other DBs
NCBI-GeneID: 108933822
NCBI-ProteinID: XP_018606686
LinkDB
Position
5
AA seq 332 aa
MSPGEHIELKDLALEGRIELAAPPGTPGQDRDPGKVRGVRLQGGRVSVDGAGEGHDFQPC
SRAQPTWCDLCGEFIWGVYKQSLRCTYCRLTCHRRCHVFVRLDCSVRRSQLGPWEDVVEA
DTNVDELVDWRTQEMSFAQVHQKVKEYNAQVCSDLHMVLNPDGSFTGFIEVRIKLVRPVC
ILFAHRAPATGLRCRTSLHLPRDMGKQLHVSSSTRAHDIVQALLSNVGVLDDPGTFALFE
RSERDGQVHLRRLADTERPLLLRLCVGPSETDMSLVLKEKSDVNWEAFSEPELHNFLRML
QREEEEHVKRVAERYARVRDRLQGALAQSTKT
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtccccgggagagcacatcgagctcaaggacctggccctagaggggcggatcgaactg
gccgcacccccagggacgccgggacaggatcgggacccggggaaggtgcgcggggtgcga
ctgcaggggggtcgcgtcagcgtggacggtgccggggaaggacacgacttccagccctgc
agccgtgcgcagcccacttggtgtgacctgtgcggagagttcatctggggcgtctacaag
cagagcctccgatgcacatactgcagattgacatgccaccgccgctgccacgtcttcgtc
agattggactgcagcgtccgccgcagccagctgggcccctgggaggacgtcgtcgaggcc
gacaccaacgtggatgagctggttgattggagaacccaggagatgtcattcgctcaagtc
catcagaaggtgaaggagtacaacgctcaggtctgcagtgacctgcacatggtcctgaat
ccagacggctccttcaccgggttcatcgaggtccggatcaagctggtgcggcccgtatgc
atcctgtttgcccacagagctccggcgacggggctgcggtgccgcacctccctccacctg
ccccgggacatgggcaagcagctgcacgtcagctcgtccacgcgcgcccacgacatcgtc
caggcgctgctcagcaacgtgggtgtgctcgacgaccccgggaccttcgctctctttgag
cgcagcgaacgcgacggccaggtgcacctgaggaggttggcagacacagagcgccccctg
ctgctgcgcttgtgcgtcgggcccagtgagacggacatgagcctcgtgctgaaggagaag
agcgacgtcaattgggaagcgttcagcgagccggagctgcacaacttcctgcgcatgctg
caacgagaggaagaggagcatgtgaaacgagtagcggagcgctacgcccgcgtccgggac
cgcctgcagggagcgctggcgcagagcaccaaaacctga

DBGET integrated database retrieval system