KEGG   Scleropages formosus (Asian bonytongue): 108934275
Entry
108934275         CDS       T04919                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108934275 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sfm04052]
    108934275 (epo)
Cytokines and growth factors [BR:sfm04052]
 Cytokines
  CSF and other factors
   108934275 (epo)
SSDB
Motif
Pfam: EPO_TPO DUF2205
Other DBs
NCBI-GeneID: 108934275
NCBI-ProteinID: XP_018607375
LinkDB
Position
4
AA seq 185 aa
MQTYVVIGLVAVLLIVLEWTRSGMPSVLKPVCDPRVLDRFIREAQDTEVAMQACRRECAL
SLSLTVPLTSVDFVAWDKKNVQEQAQEVQSGLWLLGKAIDVVRASVSNTALQSMLDNSYS
NIHSIRQVIRTLNIQDWSPSPTESASLDTRQVSSTPELFRVQTNFLRGKVRLLLSHAPAC
HRSSS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgcagacatacgttgtcataggacttgttgctgtgctgctgattgtgctggagtggact
cgctcaggaatgccttcagttctgaagcctgtctgcgacccacgtgtcctggaccgcttc
atcagggaggctcaagatacagaagttgccatgcaggcctgcagaagagagtgtgctctg
tctctgtcactcactgttcctctgacaagtgttgactttgttgcctgggataagaaaaat
gtccaggagcaagctcaggaggtccagtcaggtctgtggttgctgggcaaggccattgat
gtggtccgggcttcggtctcaaacacagcactgcaaagtatgctggataacagctacagt
aacatacacagcatcagacaagtgattcgcacccttaacatacaggactggtccccttcc
cctactgagtcagccagtttggacacccggcaggtatcatccacacccgaactcttccgt
gtccaaaccaacttcctgaggggcaaagttcgcctacttctgtcccacgcaccagcgtgc
cacaggagcagcagctga

DBGET integrated database retrieval system