KEGG   Scleropages formosus (Asian bonytongue): 108934391
Entry
108934391         CDS       T04919                                 

Definition
(RefSeq) putative transcription factor p65 homolog isoform X1
  KO
K04735  transcription factor p65
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
sfm04137  Mitophagy - animal
sfm04210  Apoptosis
sfm04218  Cellular senescence
sfm04620  Toll-like receptor signaling pathway
sfm04621  NOD-like receptor signaling pathway
sfm04622  RIG-I-like receptor signaling pathway
sfm04623  Cytosolic DNA-sensing pathway
sfm04625  C-type lectin receptor signaling pathway
sfm04920  Adipocytokine signaling pathway
sfm05132  Salmonella infection
sfm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108934391
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    108934391
  09143 Cell growth and death
   04210 Apoptosis
    108934391
   04218 Cellular senescence
    108934391
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108934391
   04621 NOD-like receptor signaling pathway
    108934391
   04622 RIG-I-like receptor signaling pathway
    108934391
   04623 Cytosolic DNA-sensing pathway
    108934391
   04625 C-type lectin receptor signaling pathway
    108934391
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108934391
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108934391
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108934391
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sfm03000]
    108934391
Transcription factors [BR:sfm03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    108934391
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 108934391
NCBI-ProteinID: XP_018607644
LinkDB
Position
4
AA seq 618 aa
MRFQPYRKDVMMTVKHYGMYSWGQTSKGNPYIEIIEQPKARGMRFRYKCEGRSAGSIPGE
KSNDTTKTHPAIKVHNYNGPIRVRISLVTKNAPYKPHPHELVGKDCKHGYYEADLQERRV
HSFQNLGIQCVKKKDVAEAIACRLQTLNNPFNVPEADIWSEEYDLNTVRLCFQASILLQS
GERYSLEPVVSQPIYDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFF
RDSWEDKGSFSQADVHRQVAIVFRTPAYNNTNLNEPVQVKMQLRRPSDGEVSEPMDFHYL
PAEPDEYRLMEKRKRTEGMFQNLKLGPIMSTGSTTGERRPFTTAKRTVTVSKPSTVMVPP
VNAVVPMVSNSQIKPEQIFGPQPGQLFSQPKPVATTSNTWFQPQPKATAATNFPPTVSAP
SQSQDYSTVNLSDLYGYNFSPFPAAKEQGAKADNRFGSSTASVVPTEAPPAAESSNTSTL
LEAQLRAEPTLCDVELHDFHSFSEVHTSGTLDSINTEDFQALLGQTGDSAGTVPGLGPST
STHNAPDLSADQTSSSTWMTYPNSIINLLQNEGIMDNVPAPSFSALEDLDEFGSLDEDRL
MSIFNSTNQAGFMPGHPT
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgcgatttcagccgtatcggaaggacgtcatgatgacagtgaagcactacggaatgtac
agttggggtcagacctctaaaggtaacccctacattgagatcattgaacagcccaaagcg
aggggaatgcgcttcaggtacaaatgtgagggcaggtctgctggcagcatcccaggggag
aagagcaacgacacgaccaagacacacccagctatcaaggttcataattataatggcccc
attcgcgtgcgcatctccctggtgactaagaatgcgccatacaagccacacccccatgag
ctggttggaaaggactgcaagcatggctactatgaggctgacctgcaggaaaggcgtgtc
cacagctttcagaacttgggcatacagtgtgtgaagaaaaaggatgtggctgaagctatt
gcctgcaggctgcagacattgaacaacccttttaacgttccagaagctgacatttggtcg
gaggagtatgacttgaacacggtgcgactgtgtttccaggcctccatcctcctccagagc
ggagagcggtactccctggagcccgttgtgtcccagcccatctatgacaaccgagctccc
aacacagcagagctgaagatctgcagagtaaaccgtaactctgggagttgtcgtggaggg
gatgagatctttctgttgtgtgacaaagtgcagaaagaggacattgaggtccgcttcttt
cgggactcctgggaggacaagggttccttctcccaggcagatgtgcacagacaggtggcc
atcgtcttccgcacgcctgcgtacaacaacacgaacctcaacgagcccgtgcaggtgaag
atgcagctgcgcaggccgtctgacggagaagtcagtgaacccatggactttcactacctg
cctgctgaaccagatgagtacaggctgatggaaaagaggaaacgtacagagggaatgttc
cagaatctcaagcttggtcccattatgtcaacaggttctactactggagagaggcgaccc
ttcaccactgccaagagaacagttaccgtctccaaaccttccactgtcatggtgccacca
gtgaatgctgtggtgcccatggtgtccaactcccaaatcaagcctgagcagatcttcggt
ccacagccaggccagttattctcccagccaaagccggtggcgaccaccagcaacacctgg
tttcagcctcaacccaaagccactgcagccaccaacttccctcctactgtctctgctccc
tcacagtcccaagactactccactgttaacctgtctgacctctacggctacaatttctcc
cccttccctgccgcaaaggagcagggagcaaaggctgacaaccgttttggaagcagcact
gcaagcgtagtgcccacagaggctcctcctgcagcagagtcctctaacacttccactctc
ttggaggcacaactaagagcggagcccactttgtgtgacgtggagctacatgatttccat
agcttctccgaggtgcacacgtccggcacgctagacagcatcaacacagaggactttcag
gcgctgttgggtcagaccggggacagcgctggcacagtacctggattgggaccctctacc
tcgacccacaatgcccctgacttgtctgctgaccaaacgagcagcagcacatggatgacc
taccccaacagcatcattaatctgctgcagaatgaaggaataatggacaatgtgccagct
cccagtttctcagcgctcgaggacttggatgagtttggatccctggacgaagaccgtctc
atgtccatttttaacagcaccaaccaagctggcttcatgcctggacaccccacttaa

DBGET integrated database retrieval system