KEGG   Scleropages formosus (Asian bonytongue): 108934405
Entry
108934405         CDS       T04919                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108934405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sfm03000]
    108934405
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sfm03310]
    108934405
Transcription factors [BR:sfm03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    108934405
Nuclear receptors [BR:sfm03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   108934405
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 108934405
NCBI-ProteinID: XP_018607684
LinkDB
Position
4
AA seq 755 aa
MDRGGLESSSEKKKSLAAHLGAMVREGSFQNDVRGSMPAASTTEESLLESWMQPVSAEFS
NGHGNGDAQEGCVHTASTSAGLCGAKPSGHVMGNSLKPQQEQQHRAMRFFAHGESSPLLE
TDIPDLDCSSPAMDTLIVGSASETFSLKIEDYTPMDGEENTFKAVGKDSDINEGLFGENT
MDLLQDLELADSLSELDDLYDGDEATLLSSLAVSDPLLRNDSALRETKVATGSGVNMNGR
GQRLSEPGCSPSAVKMEEGGYLQLCTPGVIKQENQHRGYCHMPGLEGPSLFRTPLSSCAV
STAVGPIHQFQANCSSTVSLQQLEQKPLFTLLPSLTSIDDGWNRSAQYGDATEMQRGTDS
IHALPTFTMNSISSSASPETSSLTSAGPSKSGSSAPKICLVCSDEASGCHYGVLTCGSCK
VFFKRAMEGQHNYLCAGRNDCIIDRIRRKNCPACRFRKCLQAGMNLEARKTKKLIRLKCQ
QTTAETSPPLPEELTQVVLPKSLSQLVPSMQSLLRAIEPEIIYSGYDSTIPDTSTRLMTT
LNRLGGRQVVSAVKWAKALPGFRNLHLDDQMTLLQCSWLFIMSFSLGWRSYQQSNGGMLC
FAPDLVINEERMKLPYMTEQCKQMLKISSEFVRLQVSYDEYLCMKVLLLLSTVPKDGLKS
QAIFDDIRMSYIKELGKAIAKREENSAQNWQRFYQLTKLLDSMQEMVGGLLNFCFYTFVN
KSLSVEFPEMLAEIISNQLPKFRAGSLKPLLFHQH
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggacagaggaggactcgagagcagcagtgagaagaaaaagagcttggccgcgcatctt
ggagcgatggtacgagaagggtcttttcagaacgatgtgcgcggcagcatgcccgctgct
tcaaccacggaggagtctctcctcgaatcctggatgcagcccgtgtctgcagaattctcc
aatggacacggcaacggcgacgctcaggaggggtgcgtccacacagcgtcgacctccgcg
gggctgtgtggggccaagcccagtggccatgtgatggggaacagcctaaaaccacagcaa
gagcagcagcaccgtgccatgcgtttcttcgcccatggagaaagctctcctcttctggag
acagacatccctgacctggactgctcttcacctgccatggacacccttattgttggatca
gcttctgaaactttcagtctgaaaattgaggattacacacctatggatggggaagagaac
accttcaaggcagtgggcaaggactctgatattaatgagggcctctttggtgagaacacc
atggaccttctgcaggaccttgaactggcagacagcttgtcagagttggatgatttgtat
gatggggatgaggctacacttctctcctctttggcagtgagcgaccctctccttagaaac
gacagcgcgctcagggagaccaaggtggctactggcagcggtgtaaacatgaatggcaga
ggtcagcggctgtcagagccggggtgttctccatcagctgtcaaaatggaggaaggtggc
tatcttcagctgtgcaccccgggggtgatcaagcaggagaaccagcacaggggttactgc
catatgcctggattggagggtcccagccttttcaggaccccactgtcatcatgtgccgtc
agtactgcagttggacccatccaccaatttcaagcaaactgctcatccacagtcagtctg
cagcagctggagcagaagccattatttaccttgctcccctcactgacctctatagatgat
ggctggaacagaagcgcacagtatggcgatgcaactgagatgcagagagggactgacagc
atccatgccctgcccacgttcactatgaacagcatcagctcttcagcaagtcctgaaacc
agcagtttaacttctgcagggccttcaaagtctggcagttctgcccccaagatctgtttg
gtgtgttcagatgaggcctcgggatgtcactatggtgtcctcacctgtggtagctgcaag
gtgtttttcaagagagcaatggaaggacaacacaattatctgtgcgcgggtaggaatgac
tgcatcattgacaggatccgcaggaagaactgccctgcttgccgcttccgcaagtgtctg
caggctgggatgaacctggaagcaaggaagaccaagaagctgataagactaaaatgccag
cagacaacagcagagacctcgcctcctttgccagaggaactgacacaagtggtgttgccc
aagtccctgtctcagctagtcccctccatgcagtcactactgagagctattgagccagaa
atcatctactctggttatgacagcaccattccagacacctccaccaggctaatgaccacg
ctcaaccggcttggggggcggcaggttgtctccgctgtcaaatgggctaaagccctccca
gggtttcgaaatctgcacttagatgaccagatgaccctgctgcagtgctcttggcttttc
atcatgtcctttagcctgggatggaggtcctaccagcagagcaatgggggtatgctctgc
tttgctccagacctcgtcatcaatgaggaacgaatgaaacttccatacatgacggagcag
tgtaaacaaatgctgaaaatttccagtgagtttgtgcggctccaggtgtcttatgacgag
tacctgtgcatgaaagtcctgcttctgctgagcacagtaccaaaggatggactgaagagc
caggctatctttgacgatatccgcatgtcctatatcaaagagctgggcaaggctattgcc
aaacgtgaggagaactcggcacagaactggcagaggttctaccaacttaccaaacttctg
gactccatgcaagaaatggtgggaggcctgctgaacttctgcttctacacgttcgttaac
aagtccctcagtgtggaattccctgagatgctagcagagatcatcagcaaccagctgccc
aaattcagagccggcagtctgaagccactcttgttccatcagcactga

DBGET integrated database retrieval system