KEGG   Scleropages formosus (Asian bonytongue): 108934780Help
Entry
108934780         CDS       T04919                                 

Gene name
suv39h1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1 isoform X1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sfm00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    108934780 (suv39h1)
Enzymes [BR:sfm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108934780 (suv39h1)
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108934780 (suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108934780 (suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo FerA
Motif
Other DBs
NCBI-GeneID: 108934780
NCBI-ProteinID: XP_018608379
UniProt: A0A1W4ZXK0
LinkDB All DBs
Position
Unknown
AA seq 429 aa AA seqDB search
MAENLKGCSVVCKVSLNQLQILCRQERVFCQQLEVSKKNLNDFEVEYLCDYKKIHGKEFY
LVKWKGYSESENTWEPRRNLRCVKLLKLFWADMDQELRRRKKRRNVTKLDISLASYLVQK
AKQRQLLQCWEEQLNTMRVHKGRIFVQNDVDLDGPPKDFTYINNYKVGDGIVLTEVAVGC
ECTDCLGNPVNGCCAGASLHRFAYNDRGQLRLRAGQPIYECNSRCFCGPDCPNRVVQRGI
QYDLCIFKTANGRGWGVRTMEHIRKNSFVMEYVGEIITTEEAEKRGRIYDRQGATYLFDL
DYVEDVYTVDAAHYGNISHFVNHSYVIVILCRGQLCSNDILICNPNLQVYNVFINNLDER
LPRIAFFSTRHIKAGEELTFDYKMQLDPVDAESTRMDSNFSIAGLPGSPKIRVRVECKCG
VESCRKYLF
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttgaaaggttgcagtgtggtgtgcaaagtgtccctgaaccagctgcag
atcctgtgccgccaggagagggtcttctgccagcagctagaagtgtccaagaaaaactta
aatgactttgaagtggagtacctctgcgattacaagaaaattcatgggaaggagttttac
ctggtaaagtggaagggatactcagaatcggagaatacttgggagcctcgcagaaaccta
agatgtgtgaagctgctaaagctgttctgggcagatatggatcaggagctacgacggcgt
aagaagcgacgcaacgtgacgaaactggacattagcttagcgtcttaccttgtccagaag
gccaagcagcgacagttgttgcagtgctgggaggagcagttgaacacgatgcgtgtccac
aagggtcgcatctttgtgcagaatgatgtagaccttgatggcccacccaaggattttacc
tacatcaacaactacaaggtgggggatgggattgtgctgactgaagtagcagtgggctgt
gagtgcaccgactgcttaggcaatccagtgaatgggtgctgtgctggggcttccctccac
cgcttcgcctacaatgaccggggtcagctacggctgcgtgctggacaacccatttatgag
tgcaattcccgctgcttttgtggcccagactgccccaatcgagtagtgcagagaggtatc
cagtacgacctttgcatctttaagactgctaatgggcgaggatggggagtacgtaccatg
gagcacattcgcaagaattcttttgttatggagtacgttggggagattatcacaacagag
gaagcagagaagagggggcgcatctatgatcgacagggtgctacatatctgtttgacttg
gactatgtggaagatgtgtacacagtggatgctgctcactatgggaacatttcacatttt
gtcaaccacagttatgttatagttatcttgtgcagaggacagctgtgctccaatgatatt
ctgatttgcaaccccaatcttcaggtatacaatgtattcatcaacaacctcgatgaacgc
ctcccaaggatagcttttttctccacacgtcacatcaaggctggagaagagctcaccttt
gactacaaaatgcagcttgatccagttgatgcagaaagcacaagaatggactccaatttc
agtattgctgggcttcctgggtctcccaagatacgggttagagtggagtgcaagtgtgga
gtggagtcctgtcggaagtacttattttag

DBGET integrated database retrieval system