KEGG   Scleropages formosus (Asian bonytongue): 108934828Help
Entry
108934828         CDS       T04919                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00010  Glycolysis / Gluconeogenesis
sfm00053  Ascorbate and aldarate metabolism
sfm00071  Fatty acid degradation
sfm00280  Valine, leucine and isoleucine degradation
sfm00310  Lysine degradation
sfm00330  Arginine and proline metabolism
sfm00340  Histidine metabolism
sfm00380  Tryptophan metabolism
sfm00410  beta-Alanine metabolism
sfm00561  Glycerolipid metabolism
sfm00620  Pyruvate metabolism
sfm01100  Metabolic pathways
Module
sfm_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108934828 (aldh2)
   00053 Ascorbate and aldarate metabolism
    108934828 (aldh2)
   00620 Pyruvate metabolism
    108934828 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108934828 (aldh2)
   00561 Glycerolipid metabolism
    108934828 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108934828 (aldh2)
   00310 Lysine degradation
    108934828 (aldh2)
   00330 Arginine and proline metabolism
    108934828 (aldh2)
   00340 Histidine metabolism
    108934828 (aldh2)
   00380 Tryptophan metabolism
    108934828 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108934828 (aldh2)
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     108934828 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 108934828
NCBI-ProteinID: XP_018608484
UniProt: A0A1W4ZXV5
LinkDB All DBs
Position
Unknown
AA seq 526 aa AA seqDB search
MWRRMLSGTLPRTLGRTWPSIARVLVCRYSVAAIPTPNRQPDVQFDKLFINNEWHDAVNK
KTFPTVNPATGEVICQVAEGDKADVDKAVKAAKDAFQLGSPWRRMDASDRGLLLSHLADR
IERDAAYLAELETLDNGKPYAVAYTVDVPMVVKCLRYYAGWADKWEGKTIPVDGDYFCYT
RHEPIGVCGQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLSALYVAHLIKEVGFP
PGVVNIIPGLGPIAGAAIASHMDVDKVAFTGSTEVGHLIQQASGTSNLKKVTLELGGKSP
NIIMSDADIEVAVEQAHFAVFFNQGQCCCAGSRTYVQESIYNEFVEHSVERAKRRVVGDP
FSFNTEQGPQVNEEQFKKILGYISSGKKEGAKLLCGGSVAAERGYFIQPTVFGDVKDNMT
IAREEIFGPVMQILKFRTLEEVVERANNTKYGLAAAVFTKDIDKANYISAGLRTGTIWIN
CYNVFGAQAPFGGYKASGIGRELGQYGLDNYTEVKTVVIKVPQKNS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgtcgtatgttgagcgggaccctgcctcggaccttgggccgcacctggccttcc
attgcacgggtccttgtgtgccgatactcggttgctgccattcctacacccaacaggcag
cctgatgtgcagttcgataagctcttcatcaacaacgaatggcacgatgctgtgaacaag
aagacattccctaccgtcaaccctgccaccggagaggtcatctgtcaggttgctgagggg
gacaaggcagatgttgataaggcagttaaggctgccaaggatgccttccagctggggtct
ccatggcgccgcatggacgcctctgaccgagggttgctgcttagccatttggcagaccgt
atcgagagggatgcggcatacctcgctgagctggagacactggacaacggcaagccatat
gcagtggcctatactgtggatgtccccatggtggttaaatgtctgcggtactatgctggc
tgggcagacaagtgggagggaaagaccatccctgttgatggagactacttctgctatacc
cgacatgagcccattggggtttgcggccagatcatcccatggaatttccccttgctaatg
caagcatggaagctgggtccagcactggccacagggaacacagtggtgatgaaggtggca
gagcagacacctctcagcgccctgtacgtggcccacctcattaaggaggtgggtttcccg
cctggagttgtgaacatcatccctggattgggtcccatagcaggtgcagccattgcctct
cacatggatgtggataaggtggccttcacgggctccacagaggtgggccatctgatccag
caggcatccggcaccagcaacttgaaaaaggtgaccctggagctgggtggcaagagcccc
aacatcataatgtctgatgctgatattgaggtggcagtggagcaggcccactttgccgtc
ttcttcaaccagggacaatgctgctgtgcaggctcccgcacctatgtccaggaaagtatt
tacaacgagtttgtggagcacagtgtggagagagccaagaggagagtggtgggagacccc
ttcagctttaacactgaacagggtccccaggtgaatgaggagcagttcaagaaaatccta
ggctatattagctctggtaagaaggagggggccaagctgttgtgtgggggaagtgttgca
gctgaacgtggatacttcatccagcccactgtctttggtgatgtgaaagacaacatgacc
attgccagagaggagatctttggcccagtgatgcagatcttgaagttcaggaccttggag
gaggtggtagagagagccaataacactaaatatgggctggcagctgctgttttcaccaag
gatattgacaaggccaattatatctctgctgggttacgcactggcaccatatggatcaac
tgctacaatgtgtttggggcacaggcaccatttggtgggtacaaggcctctgggattgga
cgggagttgggacagtatggccttgacaactacactgaagtgaaaacagttgtaatcaaa
gttccacagaagaattcttaa

DBGET integrated database retrieval system