KEGG   Scleropages formosus (Asian bonytongue): 108935214Help
Entry
108935214         CDS       T04919                                 

Definition
(RefSeq) period circadian protein homolog 2-like
  KO
K02633  period circadian protein 2
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108935214
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    108935214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Period_C PAS_3 PAS_11 PAS BRX_N
Motif
Other DBs
NCBI-GeneID: 108935214
NCBI-ProteinID: XP_018609152
UniProt: A0A1W4ZZS4
LinkDB All DBs
Position
3
AA seq 1536 aa AA seqDB search
MSEDSDSKRYLYSSLEDQDGGGHHPFGEGGMAACGSMSQLHLMSGYGEGRGHACEEVELG
LASEGSDSSSQEHGALPRDDRKRVVHSLHEEDMEMKSSGSSGSGSESHGNESHGNESHGN
ESHGNESLRSSSGNSKDSALLESSGSNKSSNSHSPSPPSSSNAFSLLSVSSEQDNPSTSG
CSSEESAKVKTQKELIKTLKELKLHLPSEKRNKRSASSTLNTLKYALRCVKQVKANEEYY
QMLMINDSQPSGSDVSSYTIEEIDSITSEYTMKNTDIFAVAVSLNTGKTVYISDQAASIL
NCKRDMFKNGKFVEFLTPQDVNVFYSFTTPYRLPSWSMCTGTDSSPSDCMREKSFFCRIS
GGREQEGNLQYYPFRMTPYLMKVQDTEHAEDQFCCLLLAERVHSGYEAPRIPTDKRIFTT
THTPNCVFQDVDERAVPLLGYLPQDLIGTSVLLHLHPSDRPVMLAIHRKILQFGGQPFDH
SSIRFCARNGEYITLDTSWSSFVNPWSRKVSFIIGRHKVRMGPVNEDVFAPPPFAEGKSM
DPDVQDITEHIHRLLLQPVHSNWSGGYSSSEHLLNMASSGESNGTGVRTRPEEEEALQAR
PRTFQEICKDVHMQKNLEQQLVSYSAKSESKRGADTETQQKSPVVKAKVGTLDWRESVGA
LGDRPPVQEELTYKDQPVYSYQQISCLDSVIRYLESCNVPVTVKRKCQSSSNTTSSDEDR
KKSPDAMQVSKEPALAETESHHVGMKAPKKRASGSVVGSSLAPLALPSKAESVVSITSQC
SYSSTIVHVGDKKPQPESEIIEDVAGAGESAEGSAPVPPPCAVSPPIQEREPYKKLGLTK
QVLAAHTQKEEQAFLCRFQELRGGRSFQADCSLYLDRQHGTDVAPAVRSNKQGATRAEPV
QRRGSSGVPKKGGRNKKTKWKRAKQHESSDSTASRCPQPSRAPLPNFNQTCWSASDTSQS
TFSMAYPAVMPAYPVQLYSGPRADSALSSFAENQGNREPRCSVPSSPYTAPLVTPMVALV
LPNYMFPQLGGAPRQPFYPEGASFPLQPHYPGQTHFPAPAAFPVQSQFSPHNPYPPQAAF
PTQPTLQTPSFPYGMPAESTKALGTGVQDAPSRSSTPQSLAVHDQASPPLFQSRCSSPLQ
LNLLQLEETPRSVEHQDSLTPCTAAQVNNTTEKGSTARVPKPAKELQLVSSAHEAQHSDG
HSSSSDLLDILLQEDSRSGTGSATSGSLGSGSNACDTSASGRGSSHTSNNSSKYFGSVDS
SHTSQQGVLTHAGGALEEPNKHFVKYVLQDPPWLLMANAGQAIMMTYQLPSRDLQKVLKE
DREKLRHMQKGQPRFSEEQKKELMEVHPWMRKGGLPRAIDVQACMCCEDLTSVLTEEEPP
DLDMGETSSSTCQKGSEEMLPNESDCHGHNFAPNISTCPKSKQRGIKKPHLYTLVAESHL
RHPSLQHSRVKSRQRTRPSKSLVLLNPSFPLLTSTAPETCVASSTTTSDSLQNLRLCIDR
PTPVPDQKSCLLPLCTDNKDPTIESTHLPQSPTHSE
NT seq 4611 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaggattcggactccaagcggtacctttactcttccctcgaggaccaggatgga
gggggccaccatccatttggagaaggtgggatggcagcctgtggctccatgtcccagctg
catctcatgagtggctacggggagggtcgtggccacgcgtgcgaagaggtggagctgggt
ctggcgtccgaaggcagcgacagtagcagccaggagcatggcgccctgccccgtgatgac
aggaagagggtcgtccattcactgcacgaggaggacatggagatgaagagcagtggctcc
agtggaagtgggagcgagtctcacggtaacgaatctcacggtaacgagtctcacggcaac
gagtcccacgggaacgagtcgctgcgcagctccagcggcaacagtaaggactccgccctg
ctggagtcttctgggagcaacaagagttccaactcccacagcccttcaccccccagcagt
tcaaacgcattcagcctgctgagtgtcagttctgagcaggacaatccatctactagtggc
tgcagcagtgaggagtctgccaaggtcaagacccagaaggagttgatcaagacactgaaa
gaactgaagctgcacctgccctcggagaagaggaataagcggagcgcctctagtaccctt
aacacactcaaatatgccctgcggtgcgtgaagcaggtcaaagccaatgaggagtactat
cagatgctcatgatcaacgacagtcaaccttcaggctcagacgtttcttcatacactatt
gaggagattgatagcatcacgtctgaatataccatgaaaaacacagacatttttgctgtt
gccgtgtccctcaatacgggcaagactgtgtacatctcagaccaggctgcctccatcctc
aactgcaagcgagacatgtttaaaaatggcaagttcgtggaattcctcactccgcaagat
gtcaacgtgttctacagcttcacaacaccctaccggctgccgtcctggagcatgtgcaca
ggaacagattcctcaccgtctgactgtatgcgggagaaatccttcttctgccggataagc
ggaggccgcgagcaggaggggaacctgcagtactatcccttccgcatgacgccctacctg
atgaaagtgcaggacacggaacatgccgaagaccagttctgctgcttgctgctggctgag
agggtgcactctgggtatgaagctcctcggattcccacagacaaacggatttttaccacc
acgcatacaccaaactgtgtgttccaggatgtcgatgagcgggctgtaccgctactggga
tacctgccacaagacctcataggcacatcagtcttgctgcacctccatccaagcgaccgg
cctgtcatgctggccattcacaggaagatcctacagtttgggggacaaccatttgaccac
tcctccatccgcttctgcgcccgcaacggcgagtacatcaccctggacaccagctggtcc
agcttcgtgaacccctggagccgaaaagtgtcttttatcatcggcagacacaaagtccgc
atgggtcctgtgaatgaggatgtgtttgcaccccctccgtttgctgaggggaagtccatg
gaccctgacgtccaagacattaccgagcacatccaccgtctgctgctgcagccagttcac
agcaactggtccggtggctatagcagcagtgagcacctgctcaacatggcatcatcgggt
gagagcaacggcaccggagtcagaactaggcctgaagaagaggaggccctgcaggccagg
ccacgcacgttccaggagatctgcaaggatgtccacatgcagaaaaacctagagcaacag
cttgtatcctactcggctaaatctgaatccaagagaggcgctgacacagaaactcaacag
aagagccctgtggtgaaggccaaagtagggactctggactggagggaaagtgtcggtgcg
ctgggggaccgccccccggtacaggaagagttgacctacaaggaccagcctgtctactcc
taccagcagatcagctgtctggacagtgtcatcaggtacctcgagagctgcaatgtccca
gtcaccgtgaaacgcaagtgccagtcctcctccaacaccacctcctcagatgaagacagg
aaaaaatcccccgatgccatgcaggtgtccaaagaaccagcacttgcagagaccgaaagc
caccatgtaggcatgaaggcaccaaagaagcgggcaagtggttccgtcgtggggtcgtcg
ctggcaccgttggctctgcccagtaaggcagagagtgtggtttccatcacaagccagtgc
agctacagcagtaccatcgtccacgtgggggacaagaagcctcagccagagtcggagatc
attgaggacgtagctggagcaggggagtctgcggaaggctccgcaccagtccctcctcct
tgtgcggtgtcaccacctatccaggagagagagccttacaagaagctgggtctaaccaag
caggtgctggcagcccacacacagaaggaggagcaggccttcctgtgccgcttccaggag
ctgcgtggtgggcgatctttccaggctgactgctccctctacctggaccggcagcatggc
actgacgtggcaccagctgtgagatcgaacaagcagggtgcgactagagcagagccggtg
caaaggagaggaagtagtggggtgcccaagaagggaggacgcaacaaaaagaccaagtgg
aagcgtgccaagcagcacgagtcgtcagacagcacagcttcccgctgcccacagccctct
cgtgcccccctgcccaacttcaaccagacctgctggtctgcctctgacacatcccagtcc
accttttctatggcctacccagctgtcatgcctgcctacccagtgcagctgtactcgggg
cccagggccgacagcgccttgtccagctttgcagaaaaccagggcaatcgggagccacgc
tgctccgtaccttcctcgccgtacaccgctcccttggttacccccatggtggccctggtg
ttgcccaactacatgttccctcaactaggaggtgccccacgccagcccttctacccagag
ggggcctccttcccgcttcagcctcattaccctggccagacccacttcccagccccagct
gccttcccagtgcagtcgcagttctctcctcataatccctacccccctcaggcagctttt
ccgacccaacctacgttacagaccccatcgtttccctacggcatgccggcagaatccaca
aaggccttgggaacaggtgtacaggatgccccttctcgctcctccaccccgcagtctctg
gctgtacacgaccaggcctcgcctccactcttccagtcccgttgtagctctcctctgcag
ctcaacctgttgcagctggaggagacgccccgctccgtggagcaccaggacagcttgaca
ccctgtactgctgcccaggtcaacaacacaacagagaaggggagcaccgctagagttccg
aagcctgccaaggaactgcagctggtgagctctgcacatgaggcacagcacagtgatggc
cactcatcttccagtgatctgctggacatcttgttgcaggaggactcgcgttctgggacc
ggatcggccacatcaggttcattgggctcgggatccaatgcctgtgacacatctgccagt
ggccgaggaagcagccacaccagcaacaacagtagcaagtattttggcagcgtggactca
tcccacaccagtcagcagggggtgctaacgcacgccgggggagccttggaggagcccaac
aaacattttgttaagtacgtactccaggacccaccctggttgcttatggccaacgcagga
caagcgatcatgatgacctaccagctgccctcgcgggatctgcagaaggtgctgaaggag
gacagggagaaactgagacacatgcagaagggtcagccacgcttcagtgaggagcagaag
aaggagctgatggaggtacatccctggatgaggaaaggaggtctgcccagagccattgat
gtccaggcctgcatgtgctgcgaagacctgacttcagtcctaactgaagaggagccccct
gatctggacatgggagagacaagtagcagcacctgtcagaaaggcagcgaagaaatgctg
ccaaacgagtcagactgtcacggccacaacttcgccccgaacatcagcacctgcccgaaa
tcaaaacagcggggtataaagaagccgcacctatacaccctggttgcggaatctcatttg
agacacccgtctctccagcactctcgagtgaaatcgcgacaacgtacccggccttccaag
tccctcgttctcctcaatccctcgttcccactcctgacgtccacagctcccgaaacttgc
gttgcctcctcgactacgacatcggattctctccaaaatctacgtttgtgcatcgaccga
cccacgcctgtccccgaccagaaatcctgcctgcttcccttgtgtactgacaataaagat
cccacaattgagtccacacacctacctcagtctcccacccactcagaatga

DBGET integrated database retrieval system