KEGG   Scleropages formosus (Asian bonytongue): 108935314Help
Entry
108935314         CDS       T04919                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00590  Arachidonic acid metabolism
sfm01100  Metabolic pathways
sfm04370  VEGF signaling pathway
sfm04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108935314 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    108935314 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108935314 (ptgs2)
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108935314 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF Phage_F hEGF
Motif
Other DBs
NCBI-GeneID: 108935314
NCBI-ProteinID: XP_018609334
UniProt: A0A0N8JXG4
LinkDB All DBs
Position
Unknown
AA seq 611 aa AA seqDB search
MIRTVSFVALLLLSLGSLLCEAAGDPCCSQPCQNRGVCTSGGGDQYECDCTRTGYYGQNC
STPEFFTWITTSLKPTPNTVHYILTHFRGFWNIVNNIPFLRDSVMRYVLISRSHLIDSPP
TFNSDYGYKSWEAYSNLSYYTRTLPPVPKDCPTPMGVAGKEALPDAKLVVEKFLLRSKFI
PDPQGTSLMFAFFAQHFTHQFFKSDLKKGAAFTRSLGHGVDLNHIYGETLEKQHKLRLFK
DGKLKYQVLNGEIYPPTVKDVQVEMHYPPHVPEEHRFAVGHEAFGLVPGLMMYATIWLRE
HNRVCDVLKQEHPGWDDERIFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFN
QRFQYQNRISSEFNTLYHWHPLMPDEFHIEGQVYNYQQFLFNNSIVLEHGINNLVESFSK
QIAGRVAGGHNVPAAVAMVATKSVEHSREMRYQSLNNYRKRFNMRPYTSFEELTGDKKMA
SELEELYGDIDAMELYPGLLVEKPRPNAIFGETMVEMGAPYSLKGLMGNAICSPEYWKPS
TFGGNVGFEIIKTASLKKLVCNNVKGPCPVASFQVPDMKNTVSTIINSSTAHSAQSDLKP
TVILKERTSEL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgatcagaaccgtctcttttgtggcgctcctcttactctcactgggctctttgctctgc
gaagccgcgggcgacccatgctgttcccagccgtgccagaaccgcggcgtgtgcacgtcc
ggaggaggcgaccagtacgagtgcgactgcacgcggaccggctactacgggcagaactgc
agcacccctgaattcttcacatggatcacgacttcgctgaaaccgactcccaacacggtg
cactacatcctcacacacttcagaggcttctggaatattgtcaacaacattccctttctg
agggacagcgttatgcgatatgtgttgatatccagatctcatttgatagatagccctcct
acattcaactcagattatggttacaaaagctgggaagcgtattcgaacctctcctattac
acaagaacccttcctccagtgcccaaggattgcccaacacctatgggagttgcagggaag
gaagccctgcctgatgctaagctagtggtggagaagtttcttttgagaagcaagttcatc
ccagacccacagggcacaagcctcatgtttgccttctttgctcagcatttcactcatcag
ttctttaaatctgacctgaagaagggggctgctttcaccagatctttagggcatggggtg
gacttaaaccacatttatggagaaacgttggagaagcaacacaagcttaggcttttcaaa
gatggcaagctaaagtatcaggtactgaatggggagatttatcctccaacagtaaaggat
gtccaagtggagatgcactatcctcctcatgttcctgaggagcaccgttttgcagtgggt
catgaagcctttggcctggtcccaggacttatgatgtatgccacaatctggctgcgggag
cacaatcgagtctgtgatgtgctgaagcaggagcatcccggctgggatgatgagcgcatt
ttccagaccacgaggctcattctaattggcgagaccatcaagattgtgattgaggattat
gtgcagcacctgagtggctaccacttcaagcttaagtttgaccctgagttgctcttcaac
cagcgcttccagtatcagaaccgaatctcatctgaattcaacactctttaccactggcac
cccttgatgccagatgagttccacatcgagggccaggtgtacaactaccagcagttcctc
tttaacaactccatcgtgttagaacatggcatcaacaacctagtggaatccttcagcaag
cagattgcaggcagggttgcgggtggtcataacgtgccggcagctgtggctatggtggct
acaaagtcagttgagcacagccgggagatgcgttatcagtccctgaataactacagaaag
cgcttcaatatgaggccttatacatcttttgaagaattaacaggagataaaaagatggca
tcggagctagaggaattatacggcgatattgatgcgatggagctgtatcctggtcttctt
gtggagaagccaagacccaacgccatctttggagagaccatggtagaaatgggagctccc
tattcactgaaaggactgatgggaaatgctatatgctctccagagtattggaagccaagc
accttcggtgggaatgtcgggtttgaaattatcaaaacagcatcgctgaaaaagctggtt
tgtaacaatgttaagggaccttgcccagtggcatcctttcaagtgcctgatatgaaaaac
actgtgtcaaccataatcaactccagtacagcacattctgcacaaagtgacttaaaacca
actgtcatactgaaagaacgaacatctgagctgtaa

DBGET integrated database retrieval system