KEGG   Scleropages formosus (Asian bonytongue): 108935468Help
Entry
108935468         CDS       T04919                                 

Gene name
jak1
Definition
(RefSeq) tyrosine-protein kinase JAK1 isoform X1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04217  Necroptosis
sfm04621  NOD-like receptor signaling pathway
sfm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108935468 (jak1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108935468 (jak1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108935468 (jak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108935468 (jak1)
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     108935468 (jak1)
Protein kinases [BR:sfm01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   108935468 (jak1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 Jak1_Phl FERM_F1 FERM_M SH2
Motif
Other DBs
NCBI-GeneID: 108935468
NCBI-ProteinID: XP_018609593
LinkDB All DBs
Position
9
AA seq 1146 aa AA seqDB search
MELGRQLCGKMKTRKTDAPVQALLRGLEVHFYLPDTSHLEYMKDSLSVEDLCIEAAKKCR
ISPLCHNLFALYDESKGVWYPPSHVFQIAEDTALKLHYRMRFYFTNWHGTSESEALVWRH
SLSKQRPGTDSQKIPAGTPLLDGASLEYLFAQGQQDFLKGLAPVRRPQDEAEVHDIENEC
LGMAVLAISHYAISRNLPLSGVARDISYKKYIPESLNRSIKQRNLLTRIRINNVFKNFLN
EFNNKTILDSNVTAHDLKVKYLSTLETLTENFGSEVYEPRALQICSESEGTLQGDHSLYE
VQVLGNKGIFWRKKPVSSPLITKEKQKSKKNKGVSKLEKEKRRNASDDWVLFSDFHEITH
IVTRESTVTICKQDNKNMELQLTCREKALALAALVDGYFRLTVDAHHYLCKDVAPSSVVQ
NLHNGCHGPICTEYAIHKLRQEGNEEGMYVLRWSCTNYNHILMTVVCSETGSCLSKHGRQ
YKNFQIEVEEEGYRLCGTPGLWPTLAELMGHLARQCLRTDDVSFQLRKCCRPQPREISNL
LVVTRNRVHDLPSPLQVSQLSFHRILKEEIVQGEHLGRGTRTNIYVGTLKGKPEDGEEYN
GYHFNQNMKVVLKVLDTSHRDISMAFFETASMMQQISHKHIVLLYGVSVQDQDSIMVEEF
VQLGPLDLFMRRQRSSLSMPWKFQVAKQLASALSYLEDKKLVHGYICTKNILLARDGLDS
KGGPFIKLSDPGIPITVLSREECVDRIPWIAPECIRNMAELSIAADKWSFGTTLWEICYD
GETPLKDKKLTEKEQFYVAECALATPDYKELAELMMHCMTYDPCKRPFFRAIVRDLEMLE
EQNPSIKPVPTLEVDPTVFEKRFLKKIRDLGEGHFGKVELCRYDPQGDRTGELVAVKSLK
PENREEQSGNLQSEINILRELYHENIVKYKGICSEEGGRSIRLIMEYLPAGSLKEYLPRN
KAHTDLKRLLNYAVQVCKGMDYLGSRNYIHRDLAARNVLVENENTVKIGDFGLTKSIKDN
EGYYTVKDDLDSPVFWYAPECLVHCKFYRASDVWSFGVTLYELLTYCESNSSPMMVFMRM
IGPTHGQMTVTRLVRVLEEGKRLPRPAHCPETVYSQMRRCWESSPEKRIDFKGLIEAFQQ
LLMDMK
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atggaactgggcagacagctgtgtgggaagatgaagacaaggaagactgacgcaccagtg
caagctcttctgagaggtcttgaggtgcatttctacctaccggacacctcccatttggaa
tacatgaaggacagcctctcagtcgaggacctgtgcatagaggctgccaagaagtgtcgt
atttcccctctgtgtcacaacctgtttgcgctgtacgacgagagcaaaggtgtgtggtac
ccgcccagtcacgtgttccagatcgccgaggacactgccctgaagctgcactaccgcatg
cggttctacttcacaaactggcacggcactagcgagagcgaggctcttgtgtggaggcac
tctctcagcaaacagaggcctggcactgactcccagaagatccctgcaggaaccccgctg
ctagatggtgcctcccttgagtacctgtttgcacagggccagcaagacttcctgaaaggc
ttggcccctgtgcggcgtccccaggatgaggctgaagtccatgatatcgagaacgagtgt
ctgggcatggcagtgcttgccatctcacactatgccatcagcaggaacctgccactgtct
ggtgtagcgagagacatcagctacaagaaatacattccagaaagcctcaacagatccatc
aagcagcgcaacttgctcacccgcatccgtatcaataatgtcttcaagaatttcctcaat
gagttcaacaacaagaccatcttggacagcaatgtcactgcacatgacctgaaagtcaag
tacctgtccactctggagaccctgactgagaactttggtagcgaggtctacgagccccgt
gctcttcagatctgttccgagagcgaggggaccttgcagggggatcattcgctgtatgag
gtccaggtgttggggaacaaagggatcttctggcgcaagaagccagtcagtagtccattg
ataacaaaagagaagcagaaatcaaagaagaacaagggagtcagcaaactggagaaggag
aaaaggagaaatgccagtgatgactgggtgctgttttcagatttccatgaaatcacacac
attgtcaccagagagtccaccgtaaccatctgcaagcaagacaacaaaaatatggagctc
cagctaacctgcagggagaaggccttggccctggctgctctggtggacggctacttccga
ctgaccgtcgatgcccaccattatctgtgcaaggatgtggctccttcttctgtggtccag
aacctgcacaatggttgccatggccctatctgtacggaatatgccattcacaagctgcga
caggagggcaacgaagagggcatgtatgtgctgcgttggagttgcaccaactacaaccac
atcctcatgactgtcgtctgcagcgagacaggatcgtgcctctctaaacatggccggcag
tacaagaatttccaaatcgaggtggaggaggagggctaccggctctgtgggacgccgggc
ctgtggcctacgctggccgagctgatggggcacttagccaggcagtgcctgcgcacggac
gatgtcagcttccagctgagaaagtgctgccgcccccagcccagagaaatatccaacttg
ctggtggtgacgagaaacagagtccacgacttgccgagccccctgcaagtcagccagcta
agcttccacagaatcctcaaagaggagatagtccagggggagcacctgggtcgtggcact
agaaccaacatctatgtcggcacgctgaaggggaagcctgaagatggtgaagagtacaac
ggctatcatttcaatcagaatatgaaagtggtcttgaaggtgctggataccagtcacaga
gacatctccatggccttcttcgagactgccagcatgatgcagcagatttcccacaagcac
attgtcctgctttacggtgtctccgtgcaggatcaagacagcatcatggtggaggagttt
gtccaactggggccactcgacctcttcatgcgcaggcagcgcagttccctatccatgccg
tggaagttccaggtggccaagcagctggccagcgccctcagttacctggaggacaagaag
ctcgtccatggctatatttgcaccaagaatatcctgctagctcgcgatggccttgacagc
aaagggggacccttcatcaagctgagcgacccaggcatccccatcacagtgctcagcaga
gaggagtgtgtggataggatcccgtggatcgcccctgagtgcatcaggaacatggcagag
ctgagcatagcggccgacaagtggagcttcggcacaaccctgtgggagatctgctacgac
ggcgagacgcccctgaaagacaagaagctcacagagaaggagcagttctacgtagcggag
tgtgcgctggccacgcctgactacaaggagctggcggagctcatgatgcactgcatgacc
tatgacccctgcaagaggcctttcttcagggccatcgtgagggacctggagatgctagag
gagcaaaacccctccatcaaaccagtgcccaccctggaagtggaccccacagtattcgag
aagcgcttcctgaagaagatcagggaccttggggagggccactttggcaaagtggagctg
tgcaggtacgaccctcagggcgaccgcaccggtgagttggtggctgtcaagtccctgaag
ccagaaaatcgggaggagcagagtggcaacctacagtccgagatcaacatcctgagggag
ctgtaccatgagaacattgtcaagtacaagggtatctgcagcgaggagggagggaggtcc
atcaggctcatcatggagtaccttccggccggcagcctgaaggagtacctgccccggaac
aaggcgcacaccgacctgaagaggctgttgaattacgctgtgcaggtctgcaagggaatg
gattacctggggtcccgaaactacatccatagggacttggcggcccggaacgtcctggtg
gagaacgagaacactgttaagattggagactttggcctcaccaagagcataaaggacaat
gagggctactacaccgtgaaggacgacctggacagccccgtcttctggtatgcccctgag
tgtctggtccactgcaagttctacagggcatcagacgtctggtcctttggagtcaccctg
tatgagctgctcacctactgcgagtccaactccagccccatgatggtgttcatgaggatg
atcggccccacccacggacagatgaccgttacgaggcttgtgagagtgctggaggagggc
aagaggctcccccgcccagcccactgcccagaaacggtttactcccagatgagaaggtgt
tgggaaagctctccagagaagcggatcgatttcaaagggctgatcgaggcctttcagcag
ctgctgatggacatgaagtaa

DBGET integrated database retrieval system