KEGG   Scleropages formosus (Asian bonytongue): 108935640Help
Entry
108935640         CDS       T04919                                 

Gene name
gtf2h4
Definition
(RefSeq) general transcription factor IIH subunit 4
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03022  Basal transcription factors
sfm03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    108935640 (gtf2h4)
  09124 Replication and repair
   03420 Nucleotide excision repair
    108935640 (gtf2h4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sfm03021]
    108935640 (gtf2h4)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108935640 (gtf2h4)
Transcription machinery [BR:sfm03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     108935640 (gtf2h4)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     108935640 (gtf2h4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 Tfb2_C Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 108935640
NCBI-ProteinID: XP_018609915
UniProt: A0A1W5AAA1
LinkDB All DBs
Position
23
AA seq 462 aa AA seqDB search
MKLRVQLQCKNLHEYLRELSPDILDRLYNHPATCLAVFRELPVLAKNYVMRMLFLDQALP
EAATSLWVKKDGQKEHDHCVSVLRGLRLWHSQQLQGGLQGIVLNPIFKDNLRIAVLGGGK
AWADEGSILGPDRHARDVESLDRYAMERWEVILHFMVGSPSAAVSQDLAQLLTQAGLMRS
EAGEAPCITSAGFQFLLLDTASQLWYFILQYLNTAQSRGMDLVEILSFLFQLSFSTLGRD
YSVEGMSESLLTFLQHLREFGLVFQRKRKSRRYYPTRLAITLAAGVTANSSSASMPVTPG
TGDSGFIIVETNYRLYAYTNSELQIALVALFSEMLYRFPNVVVAQVTRESVQQAIANGIT
AHQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLSFTEGVLYNQFLSQADFEV
LRDRAQELGVLVWQNAPHRVMVVTPHGHSEVKRFWKRQKSHT
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccgcgtgcagctgcagtgtaagaacctccatgagtacctgagagagctgagt
ccagacatcctggatcggctttacaaccatccagccacatgcctcgctgtgttcagggag
ctccctgtactggcgaagaactatgtgatgcgaatgctcttcctggatcaagcactccct
gaggctgccacgtccctgtgggtgaagaaggacggtcagaaggagcacgaccattgtgtg
tctgtgctcagggggcttcgcctttggcatagccagcagctccaaggggggctgcaaggg
atcgtgctgaaccccatcttcaaagacaacctgagaatcgctgttctggggggtgggaaa
gcatgggcggacgaaggcagcattctggggccagaccggcatgcgcgagacgtggagagc
ttagaccgctatgccatggagcgctgggaggtgatcctgcacttcatggtgggctcacct
agtgcagctgtgagccaggacctggctcagctgctcacgcaggctggtctcatgagaagt
gaggcaggagaagccccatgcattacctcggccgggtttcagtttcttctcctcgatacg
gcttcgcagctctggtacttcattctccagtacctcaacactgcccagtccagagggatg
gacctggtggaaattctgtcctttttgttccagctcagtttttcaacacttggaagggac
tactcagtggagggaatgagtgaatctctgctgaccttcctgcagcatctgcgtgagttt
gggctcgtcttccagaggaagaggaagtccaggagatattaccccacaaggctggccatc
accctggctgcgggcgtcacggccaacagctcctctgcctccatgcctgtcactcctggg
accggtgactctggcttcattatagtggaaacaaattatcgcctgtatgcctatacaaac
tcagaactgcagattgctctggtggccttgttcagtgagatgctataccgcttccccaat
gtggtggtggctcaggtgactagggagtcagtccagcaggccatagccaatggcatcact
gctcaccagattatccactttctgaggacaagagcacaccctgtcatgctcaaacagacc
cctgtgctcccccccacaatcactgaccagattcgactttgggagctggaacgagacagg
ctgtcattcacagaaggagtgctatataaccagttcctgtcccaggctgattttgaagtg
ctgagagacagagctcaggaattaggggtgcttgtgtggcagaacgccccacacagggtg
atggttgtgacaccccacggacacagtgaagtgaaaaggttctggaaaaggcagaaaagt
cacacatag

DBGET integrated database retrieval system