KEGG   Scleropages formosus (Asian bonytongue): 108935684
Entry
108935684         CDS       T04919                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04141  Protein processing in endoplasmic reticulum
sfm04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108935684 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108935684 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sfm03000]
    108935684 (atf6b)
Transcription factors [BR:sfm03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    108935684 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA HAUS6_N CENP-H SlyX DivIC DUF4140
Other DBs
NCBI-GeneID: 108935684
NCBI-ProteinID: XP_018610004
LinkDB
Position
23
AA seq 693 aa
MTADLLSDLDSRFFADNLLTSEDWDACLYQCESMEEGEDGDFARGLKYDAMVDNDLILTL
DPDNPTSPWKHFSDNLLPGESPVFHDDTTMAQPLPVDMLFQVKAEPLSPASSLTSDCSLS
SAPETQVIVKGENPPTPPYMFGDILSPPVGTVQVTLTPSSQPQQPQTQTHSGSEPQAQAV
VAPSPAALKASTILSSKPPIQPRPVCVATLPVSQSPSPAKALILQSLPSMDQNRPVVLSP
PVCLGSAPAIVKVEPVSPSLSHCAAPAAPATAKPIIPATSLPGTNSNDIDMKVLKRQQRM
IKNRESACQSRKKKKEYLQSLEAQLREAQRENERLRRENQALRERLAGKEGSESGNNKRA
VCIMVLLLFITFSFRPVSITERKLETGLREGAAPLTGRHLLEIGEAEDRSKTRGSERARE
ERLESEEDGEERWRRGDVDRESSDSFQLRNLSGVFSDVKDLVLPDLDRYFTSSDCRQFNR
SESLRLADELRGWAHRHQIDRKKSGGKPKMAKKARVAQKAQHRKTNFSRYLPVQTHSSVE
SQLQVFPGPEVIYSDFFDAIDRREDTFYVVSFRRDHLLLPAISHNKTTRPKMSLVMPAMS
INESMYGSAKGYEMMMQVDCEVMDTRIVPIKSSSVPPSLRDPPRPPPPQHHHGNTSIRGR
PTHSTGAAADSPRQPLHGSRREAAFYISQEGGV
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgaccgcggatctcctgtctgacttagacagccgcttttttgctgacaacctgctgacc
agcgaggactgggatgcctgtctgtaccagtgcgagagcatggaggagggagaggacgga
gacttcgccagagggctgaagtacgacgccatggtcgataacgatctcatcctgaccctc
gatcctgacaaccccacgtcgccgtggaaacactttagtgacaaccttctcccaggagaa
agccccgtgttccacgacgacacgaccatggcacagcccctgcctgtggatatgttgttt
caggtgaaggcggagcctctgtctcctgcttcctcgctgacctcagactgctccttgtcc
tcggcccccgaaacgcaggttatcgtgaagggcgagaaccctccgacgcccccttacatg
tttggagacattctgtcgccccctgtgggaacggtgcaggtgaccctgaccccgtccagc
caacctcagcagccccagacacagacccactctggcagtgaaccgcaggcccaggctgtc
gttgcaccgtctcccgctgccctcaaagccagcaccatcctgagcagtaagccgcccatc
cagccgcggcccgtgtgcgtggccacgctgcccgtctcgcagagccccagtcccgccaag
gcgctcatcctgcagagcctgcctagcatggaccagaaccggcctgtagtcctctccccg
ccggtctgcctggggtcggccccggccatcgtcaaggtggaacccgtgtctcctagcctg
tctcactgcgccgccccggccgctccagccaccgcaaagcccatcatccctgcaacgtca
ctgccagggaccaacagcaatgacattgatatgaaagtcctgaagcggcagcagcggatg
attaagaaccgcgagtcggcctgtcagtcccgcaagaaaaagaaggagtacctgcagagc
ctggaggcccagctgagggaggcacagagggagaacgagcgtctccgcagggagaaccag
gcgctgcgtgagaggctggctgggaaagagggcagtgaatcgggaaacaataagagagcc
gtgtgcatcatggtgctgctgctcttcatcaccttcagtttcagacctgtcagcatcaca
gagaggaagctggaaactggcctacgggaaggggcggcccctctcaccgggcgacacctc
ttggagatcggtgaggcggaggacaggagcaagacgcgggggagtgaaagggccagggaa
gaaaggctggagagcgaggaggacggcgaggagaggtggaggagaggcgacgtggacaga
gaatcctccgactcctttcagctcaggaacctaagcggggtgttcagtgatgtgaaggac
ttggtcctgccggacctcgaccgttactttacctcctcagactgccggcagttcaaccgc
tccgagtccctgaggctcgcggacgagctgagaggatgggcccacaggcaccagatcgac
aggaagaagtccggcgggaagccgaagatggcgaagaaagccagagtggctcagaaagcc
caacacagaaagaccaacttctccaggtaccttcctgttcagacccacagctctgtggaa
agtcagttgcaggtatttcctggacctgaagtcatctacagtgacttctttgatgccatt
gaccgcagagaagatacattctacgtggtgtctttcagacgggaccacctgctgctgccc
gccatcagccacaacaaaaccacacggcccaaaatgtccctggtgatgccagccatgtcc
atcaacgagagcatgtatggttccgccaaaggctacgaaatgatgatgcaggtggactgt
gaagtcatggacacccgcatcgtgcccataaagtcttcctccgtgcctccttccctgagg
gacccacctcgccctcctccgccccagcatcaccatggcaacacatccattcgtggacgc
cccacccacagcaccggggcggcggcagattctccgcgacaaccattgcatggcagtagg
agggaagcggcattctacatcagccaagaaggaggggtttaa

DBGET integrated database retrieval system