KEGG   Scleropages formosus (Asian bonytongue): 108935764
Entry
108935764         CDS       T04919                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04080  Neuroactive ligand-receptor interaction
sfm04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108935764
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108935764
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sfm04030]
    108935764
G protein-coupled receptors [BR:sfm04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    108935764
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 DUF1634 Ninjurin
Other DBs
NCBI-GeneID: 108935764
NCBI-ProteinID: XP_018610131
LinkDB
Position
8
AA seq 362 aa
MCMDIDGNDEPGCYCNRSVDFFYNESGKLISTVWRTKDLVVVGLGLTVCVVVILANVLVM
AAIFINRRFHYPIYYLLGNLAAADLFAGLSYLYLMFHTGPWTSKLSKGGWFIRQGLIDTS
LTASVVNLLAVAVERHQTIFTMQLHSKMTNRRVMLLILGIWVVAVIMGLIPTLGWNCLCD
LSGCSVMAPMYSRSYLVFWAVLNLVTFSIMVVVYLRIFLYVRHKSRSMSQHTTQRKHKET
VVSLMKTVTMILGAFVICWTPGLVVLLLDGLKCTACSVLKVEKFVLVLAECNSVVNPIIY
SLRDEEMLTTFKRILCCLCRRGGSQTGIPSSVRFGTLKQETIKKCETELKKMTNPNSPGD
GV
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgtgcatggacattgacggcaacgatgagcctggctgctactgcaaccgctcggtagac
ttcttctacaacgaaagtggaaagctaattagtacggtatggagaacaaaggacttagtg
gtagtgggcttgggcctcactgtgtgtgttgttgtcatcctggccaatgttctggtcatg
gctgccatcttcatcaaccggcgcttccactatcccatctactacctcttgggcaacctg
gcagcagctgacttgtttgctggcctctcttacctttatctcatgttccacacgggtcca
tggacaagcaaattgagcaagggtgggtggttcatccgccaaggcctgatcgacaccagc
ctgactgcctctgtggtcaacttgttggctgtggcagtggagcgacaccagaccatcttc
actatgcagctgcacagcaagatgacaaaccggagagtgatgctacttatcttgggcatc
tgggtggtggctgtgatcatgggtctgatccccacactgggatggaactgcctatgcgac
ttgtcaggctgttcagtcatggcacccatgtatagccgcagttacctggtcttctgggct
gtgctgaacttggtcaccttctccatcatggtggtggtctacctgcggatcttcctttat
gtacgccacaagagccgaagtatgtcgcagcacaccacgcagaggaagcataaggaaacc
gttgtgagcctcatgaagactgtgaccatgatcctaggggcctttgtgatctgctggacc
ccaggtttggtggtcctgctgctggatgggcttaagtgtacagcctgcagtgtgctcaaa
gtggagaagttcgtccttgttctggctgagtgcaactcagtggtgaaccccattatctat
tcgctacgggatgaggagatgctgacgacgttcaagcgcatcctgtgctgtctctgcagg
cggggtggcagccagacaggcataccgtcgagtgttcgctttggtactctgaagcaagag
acaattaaaaaatgtgaaacagaattaaagaagatgactaaccccaactcgcccggcgat
ggcgtttga

DBGET integrated database retrieval system