KEGG   Scleropages formosus (Asian bonytongue): 108935805Help
Entry
108935805         CDS       T04919                                 

Definition
(RefSeq) 14-3-3 protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04110  Cell cycle
sfm04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108935805
   04114 Oocyte meiosis
    108935805
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sfm01009]
    108935805
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108935805
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfm04147]
    108935805
Protein phosphatases and associated proteins [BR:sfm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108935805
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    108935805
Exosome [BR:sfm04147]
 Exosomal proteins
  Proteins found in most exosomes
   108935805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 DUF3504
Motif
Other DBs
NCBI-GeneID: 108935805
NCBI-ProteinID: XP_018610200
UniProt: A0A0P7WKG4
LinkDB All DBs
Position
6
AA seq 247 aa AA seqDB search
MADREQSVQKARLAEQAERYDDMAAAMKLVTEMNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTAADGNEKKLEMVRAYREKIEKELESVCHDVLNLLDKYLIKNCTDAQFESK
VFYLKMKGDYYRYLAEVATGEKRAAVVESSEAAYKEAFDISKEHMQPTHPIRLGLALNFS
VFYYEIQNAPEQACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
EAGETNN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagagagcagtcggtgcagaaagcccgtctggcggagcaggcggagcgctac
gacgacatggcggcggcgatgaaactggtaacggagatgaatgagccgctgtcaaacgag
gaccgcaacctgctttccgtggcttacaagaacgtggtcggggcccggaggtcctcctgg
cgagtgatttccagcattgagcagaagacggcggcggatggcaacgagaagaagctggag
atggtgcgggcctatcgtgagaagattgagaaggagctggagtcggtatgccacgatgtt
ctcaacctgcttgacaagtacctcatcaagaactgcaccgatgcccagttcgagagcaag
gtcttctacctgaagatgaagggtgactactaccgctacctggccgaagtggccacgggc
gagaagcgggccgctgtggtggagtcctccgaagcggcctacaaggaggcctttgacatc
agcaaggagcacatgcagcctacccaccccatccgcttgggcttagcgctcaacttctcc
gtcttctactacgagatccagaatgcccctgagcaggcctgccagctggccaagcaggcc
ttcgacgacgccatcgccgagctggacaccctcaacgaggactcctacaaggactccacc
ctcatcatgcagctgctgcgagacaacctcaccctgtggaccagtgaccagcaggacgac
gaagcgggggagactaataactaa

DBGET integrated database retrieval system