KEGG   Scleropages formosus (Asian bonytongue): 108935851
Entry
108935851         CDS       T04919                                 

Gene name
mpg
Definition
(RefSeq) DNA-3-methyladenine glycosylase isoform X1
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108935851 (mpg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108935851 (mpg)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     108935851 (mpg)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     108935851 (mpg)
 Prokaryotic type
     108935851 (mpg)
SSDB
Motif
Pfam: Pur_DNA_glyco
Other DBs
NCBI-GeneID: 108935851
NCBI-ProteinID: XP_018610294
UniProt: A0A0P7UM17
LinkDB
Position
8
AA seq 296 aa
MYEFAVLNPVIAMSQRKRMRVSALERESHLPVPRPLDSHSPSISPHPLDDHTPLPTKQLT
SHYFSEEQQNDLRLGEEFFNQQCVNLARAFLGKILVRRLMDGTELRGRVVETEAYLGGND
KASHSAGGKCTERNMAMFMKPGTIYVYQIYGIYLCMNVSSQEEGAAVLLRSLEPLQGQAV
MRQLRSARRRQSSRPLKDKELCNGPSKLCQALDISRAFDRRDLVSDAEVWLERDPLEALA
ESRQVVAAPRIGIEAHGEWAVKPLRFYLQGHPCVSVVDRDAERRTNFGVGPAGSSV
NT seq 891 nt   +upstreamnt  +downstreamnt
atgtacgaatttgccgttttaaatccagttatcgcaatgtcacaacggaaaaggatgcgt
gtttcagctctggagagagagagccatctgcctgtgccacgccccttggatagccattcc
cccagtatatcaccacaccccttggatgaccacactccccttcctacaaaacaacttacc
agtcattacttctctgaggaacagcagaatgacctcaggctaggagaggagttcttcaac
cagcaatgtgtgaacctggccagagccttcttgggaaagatcctggtgcgccgcttgatg
gatgggacggaactaagggggagagtggtcgagacagaggcctacctgggagggaatgac
aaggcctcccactcagcgggggggaagtgcacagagaggaacatggccatgttcatgaag
cccggcaccatttatgtgtatcagatctatggcatctacttgtgcatgaacgtatcaagc
caagaagagggtgctgctgtgctgctacgctccctcgaaccgctgcagggacaagctgtg
atgcggcagttacgctcagcccgccggagacagagctcacgaccccttaaagacaaagag
ctctgcaacggtccctccaagctgtgccaggcattggacatctctcgtgcctttgaccgc
cgcgacctggtctctgatgccgaggtatggctggagagggaccccctggaggctctggca
gagtcccgacaggtagtggcagcccctcgcatcggcatagaggctcatggagaatgggct
gtgaagcccctgcgcttttacctacagggtcacccatgcgtaagtgtggtggaccgggat
gctgagagacggaccaacttcggagtggggcctgctggcagctctgtatag

DBGET integrated database retrieval system