KEGG   Scleropages formosus (Asian bonytongue): 108935852Help
Entry
108935852         CDS       T04919                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial-like
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00250  Alanine, aspartate and glutamate metabolism
sfm00280  Valine, leucine and isoleucine degradation
sfm00410  beta-Alanine metabolism
sfm00640  Propanoate metabolism
sfm00650  Butanoate metabolism
sfm01100  Metabolic pathways
Module
sfm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    108935852
   00650 Butanoate metabolism
    108935852
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108935852
   00280 Valine, leucine and isoleucine degradation
    108935852
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108935852
Enzymes [BR:sfm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     108935852
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     108935852
Amino acid related enzymes [BR:sfm01007]
 Aminotransferase (transaminase)
  Class III
   108935852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Lenti_VIF_2
Motif
Other DBs
NCBI-GeneID: 108935852
NCBI-ProteinID: XP_018610298
UniProt: A0A1W5AAC8
LinkDB All DBs
Position
Unknown
AA seq 500 aa AA seqDB search
MASTLLSRQLGLSIQRNLRLSGSGRRHISKMATKTLDEFDYDGPSMKTEVPGPKSRELAK
QLGEIQNVGAVHFFCNYEESRGNYLVDADGNRMLDLYTQISSIPIGYNHPALLKVLSKPH
NLSTFVNRPALGILPPENFPERLMETLVSVAPRGMSRVQTMACGSCSNENAFKSMFIWYK
NKERGHNQPSQEEINSCMLNQGPGCPDLSILSFMGSFHGRTMGCLATTHSKSIHKLDVPS
FDWPIAPFPKLRYPLEEFVRENSQEEARCLEEVEDLIVKWRQKGKTVAGIVTEPIQSEGG
DNHASPDFFKKLRNIARKHGCAFHVDEVQTGCGPTGKFWAHEHWGLDDPADIVSFSKKML
TGGYFHKDEFMADKPYRIFNTWMGDPSKNIFLTEVLNVIKTERLLEEVSRSGKALLQGLY
ELQAQYPHLLSAARGVGTFCAINARDDATRDRLILKVRNKGIILGGCGEKSIRFRPALVF
KEYHVHLFLNIFNDVLAEHK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccacactgctgagtcgtcagctgggcctgtccatacagaggaacctgcgtttg
tcaggctcaggccgcaggcatatcagcaaaatggcaaccaagacactggatgagtttgac
tatgatggtccctcaatgaagacagaagtgcctggtccaaagtcaagggaactggccaaa
cagctgggagaaatccagaatgtgggtgcagtgcacttcttctgcaactatgaggaaagc
aggggaaactacctggtggatgccgacggcaaccgaatgctggacttgtacacccagatc
tcctctattcccatcggatacaaccacccagccctcctgaaagtcttgtcaaagccccac
aatctaagcacctttgtgaaccgtccagctctggggattcttccaccggaaaacttccca
gaaaggctgatggagactctcgtttcggtggcccccaggggcatgagtcgtgtgcagacc
atggcatgtgggtcctgttccaatgagaatgccttcaagtctatgttcatctggtacaaa
aacaaggaacggggccacaatcaaccgtcgcaggaggaaataaacagctgcatgctcaac
cagggcccgggctgtcctgacctcagcatcctgtcctttatggggtcatttcatggaagg
accatgggctgccttgccacaacccactcaaaatccatccacaagctggacgtgccctcc
tttgactggcccatagcccctttccccaagctgcgctacccgctggaggagtttgtacgg
gaaaattcccaggaggaggcccgatgcttggaggaggtggaagacctcatagtgaaatgg
agacagaagggcaagacggtggcggggattgtcactgagcccatccagtccgaaggcggt
gacaaccacgcctctcctgacttcttcaaaaagctgcgcaacattgcacggaagcacggc
tgcgccttccatgtggacgaagttcagacgggatgcggccccaccggaaagttctgggcc
cacgagcactgggggctggatgaccctgcagacattgtgtcttttagcaagaagatgctc
actgggggttacttccacaaagacgagttcatggcagacaagccatacaggatcttcaac
acgtggatgggcgacccatccaaaaacatcttcctgactgaagtgctaaatgtgatcaag
acagagcgcctgctggaggaggtgtcgcggtcggggaaggcactgctgcagggtttgtat
gagctgcaggcccagtacccccaccttctgagtgctgccaggggcgtgggcacattttgt
gccattaatgctcgggatgatgccacacgtgacaggctcattctcaaagtccggaacaaa
ggcatcatccttggaggctgtggtgagaagtccatcagattccgtcctgctctggtgttc
aaggagtatcatgtgcaccttttcctgaacatcttcaacgatgtgctggctgagcataag
taa

DBGET integrated database retrieval system