KEGG   Scleropages formosus (Asian bonytongue): 108936098Help
Entry
108936098         CDS       T04919                                 

Gene name
ptgs1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00590  Arachidonic acid metabolism
sfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108936098 (ptgs1)
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108936098 (ptgs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2 hEGF
Motif
Other DBs
NCBI-GeneID: 108936098
NCBI-ProteinID: XP_018610694
UniProt: A0A1W5A4B0
LinkDB All DBs
Position
Unknown
AA seq 635 aa AA seqDB search
MREVSEPPRTRQALRSSKTLPKERARRSGSERRMRASSPALICTLVVVLARGGVGGARGE
AEISGKTYDPCCHYPCQNRGVCVRFGPDRYECDCTRTGYYGENCTIPEFWSWVRQQLKPS
PDVVHYILTHFKWLWDIVNQTFLRDVFMRLVFTVRSNLIPSPPTYNSKYGYLSWESYYNT
TYYTRILPPVPEDCPTPMGVKGKATLPDPELLVEKFFLRKKFRPDPQGSNLMFAFFAQHF
THQFFKTHNRKGLEFTKALGHGVDAGHIYGDNLVRQLNLRLHKDGKLKYQMIDGEMYPPT
VMQAPVEMSYPKHVPAEQRLAIGQEVFGLLPGLSMYATLWLREHNRICDILKAEHPTWDD
EQLFQTARLIIIGETIQIVIEEYVQHLSGYLLKLKFDPSLLFSSQFQYGNRISVEFTQLY
HWHPLMPDSFHIDGSDVPYSHFLFNTSILTHYGVEKLVESFSKQPAGQVCGGHNIHHVVA
NVAVGTIKESRYLRMQPFNEYRKRFNLKPYTSFAEFTDDKVMAQELEELYGDIDALEFYP
AMLLEKARPNAIFGQSMVEIGSPFSLKGLLGNPICSPEYWKPSTFGGQTGFDIVRSATLE
KLVCLNTKWCPYVAFHVPPADYNQQEVAQKEKVEL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaagtgagcgagccgccccgaaccaggcaggcgctgcggagctcgaagaccctg
ccgaaggagcgagcgcggaggagtggatcagagcggaggatgagagcttccagcccggcg
ttgatatgcacgctcgtagtagtgctggcacgaggaggagtcggcggcgcgcgaggggag
gcggagatctccgggaaaacgtacgatccttgctgtcattacccctgccagaacaggggc
gtgtgtgtgaggtttggcccagacagatatgagtgtgactgtacccgcacaggttactac
ggagaaaactgcacgatccctgagttctggtcttgggttcgacagcagctgaaacccagc
cccgatgtggtgcactacatactgacccacttcaagtggctgtgggatattgtcaaccag
acctttctgagagatgttttcatgcgcttggtctttacagtaaggtccaatctaattccc
agtcctccaacgtacaactccaagtatgggtacctgagctgggagtcatactacaataca
acgtactatacccgcatcctgcccccagtgcctgaagactgccccacacccatgggtgtc
aaaggaaaagctacacttccagatcctgaattactggtggagaaatttttcctgaggaaa
aagttcagaccagatccccagggaagcaatctgatgtttgccttctttgctcaacatttt
acccatcaatttttcaagacacacaatcggaaggggctggaattcactaaagctctggga
catggagttgatgctgggcacatttacggcgataacctggtccgtcaactaaatctgcga
cttcacaaagacggaaaactgaaataccagatgatagatggtgagatgtaccccccaacg
gtgatgcaggcacctgtggaaatgagctatccaaaacatgtgcctgcagaacagcggttg
gccattggccaggaggtgtttgggctcctgcctggcctgtccatgtatgccaccctgtgg
ctgcgtgaacacaaccgcatctgtgacatcctgaaggcagaacatcccacctgggacgac
gagcagctcttccagacagcccgtctcatcatcattggtgagacaatccaaattgtgatt
gaagagtacgttcagcacctgagtggttacctgctgaagctgaagtttgaccccagcctg
ctgttcagctcccagttccagtacgggaatcgcatttctgtggagttcacccagctgtac
cactggcaccctctaatgccggacagcttccacattgatggcagtgacgttccctattcc
cacttcctcttcaacacctcaattctgacccattatggtgtggagaaacttgtggagtcc
ttttcaaaacaaccagctggccaggtatgtgggggtcacaacattcatcatgtggtggca
aatgtggctgtgggcaccattaaggaatccagatacctgcgcatgcagcccttcaacgag
tacaggaagcggtttaacttgaaaccttacacatcctttgccgaattcacagatgacaaa
gttatggctcaggagttagaggagctctatggagatattgatgccttagagttctaccct
gcaatgctgcttgagaaggcgcgccccaacgccatatttggtcagagtatggtggagatc
gggtcacctttttccttgaaagggctcttgggaaaccccatctgctctccagagtactgg
aagcccagcacctttggtggtcaaacagggtttgacatcgtcagatcggcaacgctagag
aagctggtgtgcctcaacacaaagtggtgtccatatgtggcttttcatgtgccaccagca
gattacaaccaacaggaagttgcacagaaggagaaggttgagttgtag

DBGET integrated database retrieval system