KEGG   Scleropages formosus (Asian bonytongue): 108936118Help
Entry
108936118         CDS       T04919                                 

Gene name
rfc3
Definition
(RefSeq) replication factor C subunit 3 isoform X1
  KO
K10756  replication factor C subunit 3/5
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03030  DNA replication
sfm03420  Nucleotide excision repair
sfm03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108936118 (rfc3)
   03420 Nucleotide excision repair
    108936118 (rfc3)
   03430 Mismatch repair
    108936118 (rfc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108936118 (rfc3)
   03036 Chromosome and associated proteins [BR:sfm03036]
    108936118 (rfc3)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108936118 (rfc3)
DNA replication proteins [BR:sfm03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    108936118 (rfc3)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     108936118 (rfc3)
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    108936118 (rfc3)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     108936118 (rfc3)
  Check point factors
   HRAD17(Rad24)-RFC complex
    108936118 (rfc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol3_delta2 Rad17 AAA AAA_22 AAA_16 DNA_pol3_delta Rep_fac_C ABC_tran AAA_11 Prenyltransf AAA_5
Motif
Other DBs
NCBI-GeneID: 108936118
NCBI-ProteinID: XP_018610725
UniProt: A0A0P7WRG4
LinkDB All DBs
Position
4
AA seq 356 aa AA seqDB search
MSLWVDKYRPTSLGKLDYHKDQANQLKNLVQCGDFPHLLVYGPSGAGKKTRIMCLLRELY
GPGVEKLRIEHQSITAPSKKKIEINTIASNYHLEVNPSDAGTSDRVIIQELIKTVAQSQQ
IQSSTQREFKVVLLTEVDRLTKDAQHALRRTMEKYMATCRLILCCNSTSKVISPIRSRCL
AVRVPLPSVEEVCAVLTSVCRKEGLLLPAELAKQIAEKSGRNLRKALLMCEACRVQQYPF
STDQDIPEADWEVYLRETANAIVSQQSPQRLLEVRARLYELLTHCIPPEIIIKGLVSELL
SNCDGHLKAEVAQMAAYYEHRLQLGNKAIYHLEAFVAKFMAIYKKFMEDGLDGMMF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagcctatgggtggacaaatacaggcctacctccttggggaaactggactatcacaaa
gatcaggcaaaccagctgaagaatttggtacaatgtggtgatttcccacacctgctggtt
tacggtccatccggcgcagggaagaagacccggataatgtgtttattgagggagctctat
ggtcccggagtggagaagcttcgcattgaacatcagtccattacggcaccatcgaaaaag
aagattgaaatcaacactatagcgagcaactatcacttggaagtaaatccgagtgatgct
gggaccagtgatcgtgtgattattcaggagctcatcaaaactgttgcacagtctcagcag
atccagtccagtacacagagagagttcaaagtggtgctactgacagaggtagaccgacta
accaaggacgcccagcatgccttgcggcggactatggagaagtatatggccacctgcagg
cttatcctgtgctgcaactccacatccaaggtcatctccccaatccgcagcagatgcctg
gctgtgcgggtgccactgcccagtgtggaggaggtgtgtgctgtcctgaccagtgtgtgc
aggaaggagggcctattgcttccagcagagctagccaagcagattgctgaaaagtcaggc
cgcaaccttcgcaaggcattgctcatgtgtgaagcttgccgtgtccaacagtatcccttc
tcaacagaccaagacatacctgaggcagactgggaggtatacttgagagagacagccaac
gctattgtcagccagcagagtcctcaaaggcttctggaggtgcgtgctcgactctatgaa
cttctcacccactgcatccctccggaaataatcatcaagggtctggtgtcagagcttcta
agtaactgtgatggacacctgaaggctgaggtagcccagatggcagcatattatgagcat
cggctgcaactgggcaacaaggcaatctaccacctggaagctttcgtggcaaagtttatg
gccatctacaagaagttcatggaggatggactggatggcatgatgttctga

DBGET integrated database retrieval system