KEGG   Scleropages formosus (Asian bonytongue): 108936270
Entry
108936270         CDS       T04919                                 

Definition
(RefSeq) high mobility group protein B1-like
  KO
K10802  high mobility group protein B1
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
sfm04140  Autophagy - animal
sfm04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108936270
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108936270
  09143 Cell growth and death
   04217 Necroptosis
    108936270
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sfm03036]
    108936270
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108936270
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfm04147]
    108936270
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    108936270
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     108936270
   MMR (mismatch excision repair)
    Other MMR factors
     108936270
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   108936270
SSDB
Motif
Pfam: HMG_box HMG_box_2 HMG_box_5 Autophagy_act_C NOA36 Nucleo_P87
Other DBs
NCBI-GeneID: 108936270
NCBI-ProteinID: XP_018611071
LinkDB
Position
4
AA seq 215 aa
MGKDPTKPRGKMSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWKTMSAKEKGKFE
DLAKLDKARYEREMKNYIPPKGEKKKKRFKDPNAPKRPPSAFFIFCAEFRPKVKEETPGM
SIGDVAKKLGEMWNSTSSEDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDGGPKKAPAKPE
KAKKKKKDDDDDDDDDDDDDDDDEEDEDDEEDDDE
NT seq 648 nt   +upstreamnt  +downstreamnt
atgggtaaggatcctactaagcccaggggcaagatgtcttcctatgcctactttgtgcaa
acttgtcgggaagagcataagaagaaacacccagaagcctctgtcaacttctcggaattc
tccaagaagtgttcggaaagatggaagactatgtctgccaaagaaaagggcaagtttgaa
gatctggctaagctggacaaggcacgttatgagagggagatgaagaactacatcccacca
aagggtgagaagaagaagaagaggtttaaggatccaaatgctcccaaaagacccccgtct
gctttcttcatattctgcgctgaattccgcccgaaagtcaaggaagagacccctggcatg
tccatcggtgatgtggccaagaaacttggtgagatgtggaacagcacctcatcggaggac
aagcagccgtatgagaagaaggctgccaagctgaaggagaagtatgagaaggacattgct
gcctaccgtgctaagggcaagcctgatggtgggcccaagaaggcacctgccaagccggaa
aaggccaagaagaagaagaaggacgacgatgatgacgacgatgatgatgatgacgacgat
gacgacgatgaggaggacgaggacgatgaggaagatgacgatgaataa

KEGG   Scleropages formosus (Asian bonytongue): 108941932
Entry
108941932         CDS       T04919                                 

Definition
(RefSeq) high mobility group protein B1-like
  KO
K10802  high mobility group protein B1
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
sfm04140  Autophagy - animal
sfm04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108941932
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108941932
  09143 Cell growth and death
   04217 Necroptosis
    108941932
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sfm03036]
    108941932
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108941932
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfm04147]
    108941932
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    108941932
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     108941932
   MMR (mismatch excision repair)
    Other MMR factors
     108941932
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   108941932
SSDB
Motif
Pfam: HMG_box HMG_box_2 HMG_box_5 Autophagy_act_C YABBY
Other DBs
NCBI-GeneID: 108941932
NCBI-ProteinID: XP_018620376
LinkDB
Position
10
AA seq 203 aa
MGKDPKKPRGKMSSYAYFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKAKFE
ELAKQDKVRYEREMKNYVPPKGEKKKRTKDPNAPKRPPSAFFIFCADHRPKIKSENPGLS
IGDIAKKLGEMWNSTSAEDKQPYEKKAAKLKEKYDKDIAAYRGKGKPAPATATKAKKKDD
DEDDDDEEDEDDEEDEEEDDDDE
NT seq 612 nt   +upstreamnt  +downstreamnt
atgggaaaagatccgaagaagccgagaggcaagatgtcgtcctatgcctactttgtgcag
acttgcagggaggagcataagaagaaacacccagatgccagcgtcaacttctcagagttc
tctaagaagtgctctgagcgatggaagacaatgtctgccaaggaaaaggcaaaatttgaa
gagttggccaagcaagacaaggtccgttatgagagggaaatgaagaactatgtcccacca
aagggcgagaagaagaagcgaacaaaagatcccaatgctcctaagagacccccatctgca
ttcttcatattctgtgctgaccatcgcccaaaaatcaagagtgagaatcctggactgtct
attggagacatagcaaagaagctgggagagatgtggaacagcacatctgcagaagacaag
cagccatatgagaagaaggcagctaaactgaaggagaaatatgataaggacattgcggcc
taccgtggcaaaggcaagccagctcctgccacagcaacaaaggcaaagaaaaaagatgac
gatgaggatgacgatgatgaggaggatgaggatgatgaggaggatgaagaggaagatgat
gatgatgaataa

DBGET integrated database retrieval system