KEGG   Scleropages formosus (Asian bonytongue): 108936597Help
Entry
108936597         CDS       T04919                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src-like
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04012  ErbB signaling pathway
sfm04137  Mitophagy - animal
sfm04144  Endocytosis
sfm04370  VEGF signaling pathway
sfm04510  Focal adhesion
sfm04520  Adherens junction
sfm04530  Tight junction
sfm04540  Gap junction
sfm04625  C-type lectin receptor signaling pathway
sfm04810  Regulation of actin cytoskeleton
sfm04912  GnRH signaling pathway
sfm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108936597
   04370 VEGF signaling pathway
    108936597
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108936597
   04137 Mitophagy - animal
    108936597
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108936597
   04520 Adherens junction
    108936597
   04530 Tight junction
    108936597
   04540 Gap junction
    108936597
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108936597
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108936597
  09152 Endocrine system
   04912 GnRH signaling pathway
    108936597
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108936597
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108936597
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sfm04131]
    108936597
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     108936597
Protein kinases [BR:sfm01001]
 Non-receptor tyrosine kinases
  SRC family
   108936597
Membrane trafficking [BR:sfm04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    108936597
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    108936597
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    108936597
  Macropinocytosis
   Kinases
    108936597
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_3 hSH3 SH3_10 zf-RING_14
Motif
Other DBs
NCBI-GeneID: 108936597
NCBI-ProteinID: XP_018611588
LinkDB All DBs
Position
24
AA seq 531 aa AA seqDB search
MGATKSKPKDLGQRPRSLDGTIGPFAGFNPSQASSRAPASGDGGWVEQPPTKKPEMFIFG
GVDPNESLNPPQQSSQLAGGVTTFVALYDYESRTASDLTFKKGERLQILNNTEGDWWLAR
SLATGQSGYIPSNYVAPTDSIRAEEWFFGNLTRRDSERLLLGSEGRGGTFLVRESETTKG
AYCLSVLDVSDIKGFNVKHYKIRKLDSGGFYITSRAQFSTLQQLVNHYRKLADGLCQCLT
DVCPVMKPQTQGLSRDAWEIPRSSLRLDVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTM
SPEAFLQEAQIMKKLRHEKLVQLYAVVSEEPIYIVTEYMPKGSLLDYLKGDAGRMLRLPQ
LVDMASQIAAGMAYVERMNYVHRDLRAANILVGDKMVCKVADFGLARLIEDNEYTARQGA
KFPIKWTAPEAALYGRFTIKSDVWSFGILLTELATKGRVPYPGMVNREVLEQVERGYRMP
CPTECPESLHDLMLTCWRREPEERPTFEYLQGFLEDYFTSTEPQYQPGENL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgggggcaaccaaaagcaagccaaaggatttgggccagaggcctcgaagcctggacggc
accatcggtcctttcgccggattcaatccatcccaggcatccagcagagcccctgcatca
ggggacggcggatgggtcgagcagccccccaccaagaagccggagatgttcattttcggg
ggagtggatcccaacgagagcctgaatcccccacagcaaagttcgcagctggcaggaggg
gtcaccacctttgtggcgctgtacgactacgaatcgcgcaccgcctcggacctcaccttc
aagaaaggcgagaggctgcagatactcaacaacacggagggggactggtggctggcccgt
tcactcgctacaggacaaagcggatacattcccagcaactacgtcgcccccacggactcc
atcagggcggaggagtggtttttcgggaatctcacccgccgcgactcagagaggctgctc
ctgggctccgagggcagaggagggactttcctcgtgagggaaagcgaaaccaccaagggt
gcgtactgcctgtctgttctggatgttagcgacataaagggcttcaacgtcaaacactac
aagatccgcaagctggacagtggaggattctacatcacgtcccgggcgcagttcagcacc
ctgcagcagctggtcaaccactaccgcaagcttgcagacggcctgtgccaatgcctgaca
gacgtgtgccccgttatgaagccccagacgcaaggcctgtccagagacgcctgggaaatc
cctcgcagctccttgcggcttgacgtgaagctgggtcagggttgcttcggagaggtctgg
atgggaacctggaacggtacgacgcgggtggccatcaaaaccctgaagccgggcaccatg
tctccagaggccttcctgcaggaggcgcagatcatgaagaagcttcggcacgagaagctg
gtgcagttgtacgctgtggtgtccgaggagcccatctacatcgtcaccgagtacatgccc
aaaggtagtctgttggattaccttaaaggtgatgcaggcaggatgctgcgactgccacag
ttggtggatatggcctcgcagattgcagcaggaatggcctacgtagagaggatgaactac
gtgcacagggaccttcgggcggccaacattctcgtgggggacaagatggtgtgcaaagtg
gccgacttcggtctggcccgtctcattgaggacaatgagtacacggcaaggcaaggagca
aagtttcccatcaagtggacagccccggaggcggcgctctacggtcgcttcaccatcaag
tctgatgtgtggtccttcggaatcctgctcacagagctggccaccaagggcagggtgcca
tacccaggaatggtgaacagggaagtgctggagcaggtagagcgtggctaccgcatgccc
tgtccaaccgaatgccccgagtccctgcacgacctgatgctcacctgctggcgacgggaa
ccagaggagcggcctacatttgagtacctgcagggctttctggaggactacttcacctcc
acggaaccccagtaccagccgggggagaatctttag

DBGET integrated database retrieval system