KEGG   Scleropages formosus (Asian bonytongue): 108936742Help
Entry
108936742         CDS       T04919                                 

Gene name
gaa
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00052  Galactose metabolism
sfm00500  Starch and sucrose metabolism
sfm01100  Metabolic pathways
sfm04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108936742 (gaa)
   00500 Starch and sucrose metabolism
    108936742 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    108936742 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfm04147]
    108936742 (gaa)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108936742 (gaa)
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108936742 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 108936742
NCBI-ProteinID: XP_018611814
UniProt: A0A1W5A7I9
LinkDB All DBs
Position
Unknown
AA seq 947 aa AA seqDB search
MTFQKNQWAVCSNPTRSILLSLSLGLAVLSFTACVCMRCVYKQSAVAASHEMGIRALNAW
DQVPRVQKFSRSPVDLQRSAGSRLGGPPKGDECALPSESRFDCARDRALSREECEERGCC
YAPLTQSISSGPPWCFYPPSYPGYSMGPLSPTSRGQAATLTRSVPSYLPREVSTLRLEVM
LETENRLHLTLKDPTSPRYEVPLSETHPGSSSEGQEPLYILQFLPSPFGFTVQRRSSGRV
LLNTTVAPLLFADQYLQLSTSLPSGLISGLGEHYTPISLDLNWTSITLWNHDVAPHSDLN
LYGSHPFYLVQEDDGKAHGVFLLNSNAMEVVLQPTPALTWISTGGVLDLYVFLGPDPQDV
VRQYHEVIGFPMMPPYWALGFHLCRWGYTTTNATRDVVHRMRSAGFPLDAQWNDIDYADG
RKVFTFDPQRFADLPAMVNEFHREGLKYVLILDPGISSTAPPGSYPPFDEGLQRGVFIRN
STGQLLIGKVWPGLTAFPDFTNPETRSWWEDNIRAFHDRVPFDGLWIDMNEPASFVSGSV
EGCPDTDLENPPFVPGIIGRHLNSGTLCMSAQQNLSSHYNVHNLYGLTEASATHSALVKV
RRSRPFVLSRSSYPGLGRFSGHWTGDVQSDWDQLRYSVPAVLLFGLYGIPLVGADVCGFG
GDTTEELCVRWTQLGAFYPFMRNHNDKPNASQEPFVFSPQAQDAMRRAILLRYSLLPLLY
TLFHHAHVSASTVARPLFLEFPSDPNCQTIDRQFLWGDSLLISPVLEQGMTELAAYLPPG
IWYSLHNGQPYYSKGQYLLLPAPLDTINVHLRAGHIIPQQEPALTTGASRTNPFLLTVAL
SAEGGAWGELFWDDGDSLDTYEKKDFSFIVFSAGQDKVVSEPLMVNRALDGLLLGRVRIF
GVLSAPQEVQANGEQVKDMVYHSDTKMLTVSGLHLPMAEPFIIQWIL
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgaccttccagaagaaccagtgggcggtgtgttcgaatcccactcgatccatccttctg
tccctttcgctgggcctcgcggtgctctcgttcaccgcctgtgtgtgtatgcgctgtgtg
tataaacagtcagcggtggcagcctcgcacgaaatgggcatcagagcgctgaatgcatgg
gatcaagtgccacgcgtgcagaagttttcaagaagccctgtagacctccagcggagcgct
gggtctcgcctcggtggaccaccaaagggtgatgagtgtgcgctcccgtcagaaagccgc
ttcgattgtgcacgggaccgagccttgagccgggaggagtgcgaagaacgtgggtgttgc
tatgctcccctgacccagagtatctccagtgggccaccctggtgcttttaccccccttct
taccccgggtacagcatgggaccgctctctcccacttcccggggacaggcagcaacactg
acacgctctgtgccctcatacctcccccgggaagtctccacactccgactggaagtcatg
ttggagacggagaaccggctgcatctgaccctgaaggatcctacttctccacgctatgag
gtcccgctgtcagaaacacatcctgggagcagcagtgagggccaggaacccttgtacatt
ttacagttcctcccttccccttttggattcacagtacagcgcagatccagcggtcgtgtt
cttttgaacaccacggtggcgcccctgctttttgctgaccagtacctgcaactgtccacc
tcactgccctcaggcctgatctcaggcctgggggagcactacacccctatcagtctggac
ctcaactggacctccatcactctgtggaaccatgacgtggcacctcacagtgatttgaac
ctgtatggatcccacccattctatctggtgcaggaagatgatggcaaggcccatggggtc
ttcttgctcaacagcaatgccatggaggtagtgttgcagcccaccccagctctcacgtgg
atctccactgggggggtcctggatctatatgttttcctgggtcctgatccacaggatgtg
gtccgacagtaccatgaggtgattgggtttcccatgatgccaccctactgggctctgggc
ttccacctctgtcgctggggttacaccaccaccaatgccactcgagatgtggttcatcgc
atgcgcagtgccggcttccccctggacgcacagtggaatgacattgactacgcagacggt
cggaaagtgttcacctttgatcctcagcgttttgctgacctccctgccatggtgaatgag
ttccaccgagaaggcctgaaatatgtcctcatactggacccagggataagcagcacagct
ccacctggatcctaccccccgtttgatgaagggctgcagagaggagtatttatcagaaac
tcgactgggcagctactcatagggaaggtgtggccaggtctgacagctttccctgatttc
acgaacccggagaccaggagctggtgggaggacaatatccgtgccttccatgaccgagtc
cccttcgacggcctgtggattgacatgaatgagcctgcgagttttgtgagtggttccgtc
gagggctgtccagacaccgacctggagaaccccccgtttgtaccggggatcattggcagg
catctgaattctgggactctgtgtatgtctgctcagcagaatctctcctctcattacaac
gtgcacaacctctacgggctgacggaagccagcgccacacacagtgccttggtgaaggtt
cgaaggtcacgacccttcgttctgtcccgttcctcctacccgggtcttggtcgcttctcg
ggccactggacaggagacgtgcagagtgactgggaccagctacgctactctgtccctgcg
gtgttgctgtttggcctgtacgggatcccactggtgggggcagatgtatgcggttttggg
ggcgacacgaccgaggagctgtgtgtgcgctggacccagctgggtgctttctatcccttc
atgagaaaccacaatgacaagcctaacgcgtcccaggagccctttgtgttcagtccacag
gcccaggacgccatgaggagagccatcttgctgcgctactccctccttccgctgctctac
actctgttccaccatgctcacgtctccgccagcactgtagccaggcctctcttccttgag
ttcccctctgatcctaactgccagacaattgacaggcagtttctgtggggggattcacta
ctgataagcccggtcctcgagcaaggaatgacggaactggcggcctacctgccccctggg
atctggtacagtctgcacaatggacaaccgtactacagcaagggtcagtatcttcttctc
ccggcaccgctggacaccatcaacgtccatctaagagctggtcacatcattccgcaacag
gagccggcgctgacaaccggtgcctcgcgtacaaacccctttctcttgactgtggctctg
tctgctgagggcggggcgtggggtgagctgttctgggatgatggtgacagtctggatact
tatgaaaagaaagatttctcctttatagtcttcagtgcaggacaggataaggtggtgagt
gagcccctcatggtgaacagagccctggatggattgctgctgggaagggttcgcattttt
ggggtgctgtcagcacctcaggaggtgcaggcaaatggggagcaggtgaaagacatggtg
taccactctgacaccaagatgctgaccgtgtccggtctgcaccttcctatggcagagcct
ttcatcatccagtggatcctctga

DBGET integrated database retrieval system