KEGG   Scleropages formosus (Asian bonytongue): 108936823
Entry
108936823         CDS       T04919                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
sfm04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108936823 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108936823 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sfm04052]
    108936823 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:sfm00536]
    108936823 (fgf1)
Cytokines and growth factors [BR:sfm04052]
 Growth factors
  Growth factors (RTK binding)
   108936823 (fgf1)
Glycosaminoglycan binding proteins [BR:sfm00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   108936823 (fgf1)
SSDB
Motif
Pfam: FGF Endonuc-PvuII
Other DBs
NCBI-GeneID: 108936823
NCBI-ProteinID: XP_018611928
LinkDB
Position
13
AA seq 220 aa
MTSSSCHSFIDCAAAAPPCLRSESGRRDYGTGLVSLGHTDPECQCGIMGSGEGALRSAAP
RQPHATMTDGEVSLLGAGMGVALYHHTRPRRLYCLNGGFHLRILADGTVEGSRDEDDPYN
VLRVKAVSIGVVVIEGMEGGCYLAMDQDGQLYGSPTLNDECYFFEKLEENHYNTYMSQKY
RERSWYVGIKKNGRPKAGPRTHIGQKAIYFLPRALEGASE
NT seq 663 nt   +upstreamnt  +downstreamnt
atgacgtccagcagctgtcattcattcattgactgtgccgctgctgctcctccctgcctt
cgctccgaaagtggccgtagagactacgggacaggtttagtgtcgctcggtcacactgat
cccgagtgtcagtgcggaatcatgggaagcggtgagggtgcgctccggagtgccgctccg
cgacagccgcacgccactatgaccgacggggaggtgtcgctgttgggcgcgggcatgggc
gtggccctttaccaccacacgcggccccggcgtctctactgcctgaacggcggcttccat
ctgcgcatcctggccgacggcacggtggagggcagccgggacgaggacgacccctacaac
gtgctgcgtgtgaaagccgtcagcattggcgtcgtcgtcattgagggtatggaggggggc
tgctacctggccatggatcaagacgggcagctttacggctcgccgaccctgaacgacgag
tgctacttttttgagaagctggaggagaaccactacaacacgtacatgtcccagaagtat
cgggagagaagctggtacgtggggatcaaaaagaacgggcgcccgaaagccggacccagg
acccacatcgggcagaaggccatctacttcttgccccgtgcgctcgaaggtgcgagcgaa
tga

DBGET integrated database retrieval system