KEGG   Scleropages formosus (Asian bonytongue): 108936904Help
Entry
108936904         CDS       T04919                                 

Gene name
samhd1
Definition
(RefSeq) deoxynucleoside triphosphate triphosphohydrolase SAMHD1 isoform X1
  KO
K22544  deoxynucleoside triphosphate triphosphohydrolase SAMHD1 [EC:3.1.5.-]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108936904 (samhd1)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.5  Triphosphoric-monoester hydrolases
    3.1.5.-  
     108936904 (samhd1)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     108936904 (samhd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HD SAM_2 SAM_1 PDEase_I
Motif
Other DBs
NCBI-GeneID: 108936904
NCBI-ProteinID: XP_018612066
UniProt: A0A1W5AGV0
LinkDB All DBs
Position
2
AA seq 626 aa AA seqDB search
MDGRKRPRDGASSSDSFYTPKKQLADCRPPIPDFREWDVEGTCRFLREEGFAGDLEGKFR
AEKITGVCLPYLTEPQLENMGIGPLGVRLQLLSSLKKLWQIFADAIKVFNDPIHGHIEMH
PLLVRIIDTPQFQRLRYIKQLGGTYFVFPGACHNRFEHSIGVGHLAGRLVQALNERQPEL
LISPRDMLCVQIAGLCHDLGHGPFSHMFDGMFIPKMRPDYKWKHEMASVQMFDHMVKVNS
LEPVMKEHGLVLPTDLLFIKEQIAGPLDPPHPGTANQMEGWPYQGRSEEKGFLYEIVANK
RNGIDVDKWDYFARDCYHLGIQNNFDYRRFLKFARVCEVDNKKHICTRDKEVGNLYDMFH
TRNCLHRRAYQHKVGNIIETMITEALEKADKHIKILGSGGKIFSISTAIDDMEAYTKLTD
HVFEQILYSSSKELAEARAILNNVVVRKLYKCVGQTQPKRPLDITMNNLLQWAKDVSVAK
PRSGTDVTFQGEDFVISVIDMDYGMKEKNPINNVRFYCKNDPSKAIKIRKNQVSQLLPEK
FAEQLIRVYCKRTDAKSLEAAKKYFVQWCINKDFIKPQDGDVIAPELTPLKDSWVADDNS
DDDGNSQDKHHHPSRNGIHSVKVRLF
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggatggcagaaagcgtccccgggatggagcttcgagctccgactccttctataccccg
aagaagcagctggctgactgccgcccgcccatccccgacttcagggagtgggatgttgag
ggaacgtgccggtttctgcgggaagaggggttcgccggagacctcgaagggaagttccga
gcggagaagatcactggggtgtgcttaccgtacctcacggagccgcagctagagaacatg
ggtatcggcccactaggggtgcggttgcagcttctctcctccttgaagaagctctggcag
atatttgctgatgccattaaggtgttcaatgaccccatccatggccacatcgagatgcac
cctctgcttgtgcgcatcatcgacaccccacagttccagaggctgcgctacattaaacag
ctgggtggcacctactttgtttttcctggagcctgtcacaaccgctttgagcactccatc
ggggtgggtcaccttgctggccgcttggtccaggccctgaacgaacgtcagccggagctg
ctcatcagccccagggacatgctgtgcgtgcagattgccggcctgtgccacgacctcgga
catggccccttctctcatatgttcgatggaatgtttatcccaaaaatgcgtcctgattac
aagtggaagcacgagatggcgtctgtgcagatgttcgaccacatggtcaaggtgaacagt
ctggagcctgtcatgaaggagcatggtctggtacttccgacggacctattgttcatcaag
gagcagattgctggacccctggaccccccccacccagggacagccaatcagatggaagga
tggccgtatcaaggtcgctcagaagaaaagggcttcctctacgaaattgtggcaaacaaa
aggaatggcatcgatgtggacaagtgggattactttgccagggactgttatcatcttggg
atccagaacaattttgactacaggcgcttcctcaaatttgcacgtgtttgtgaggtggac
aacaagaagcacatctgcaccagagacaaggaggtggggaacttgtatgacatgtttcac
accagaaactgcctccatcgcagggcgtaccaacacaaagtggggaatatcattgaaacc
atgataacagaggctcttgagaaggctgataagcacatcaagattttaggctctgggggc
aagatcttctccatctccactgctatagatgacatggaggcctacaccaagctcacagac
catgtgtttgagcagatcctgtactcctcaagcaaggagcttgctgaggcacgggccatc
ctcaacaacgtcgtcgttcgaaagctctacaaatgtgtgggccagacgcagcccaagcgg
cccctggacatcacaatgaacaacttgcttcagtgggccaaggatgtttccgttgccaag
cctcgtagcggcacagacgtgacctttcagggggaagacttcgtcataagtgttatcgac
atggactatggcatgaaggagaagaacccgattaataacgtgcgcttctactgcaagaat
gaccccagcaaagctatcaagatccggaagaaccaggtctcccagctcctgcctgagaag
tttgcggagcagctgatccgtgtgtactgcaagcggacggacgccaagagcttggaagcg
gcaaagaagtactttgtacagtggtgcatcaacaaagacttcattaagccgcaggatggg
gatgtgatcgcacctgagctcaccccgctgaaggacagctgggttgctgacgacaacagc
gatgatgacggcaactcccaggataaacaccaccacccttccaggaacggcatccatagt
gtaaaagtccgacttttctaa

DBGET integrated database retrieval system