KEGG   Scleropages formosus (Asian bonytongue): 108938597Help
Entry
108938597         CDS       T04919                                 

Definition
(RefSeq) tyrosine-protein kinase ABL1-like isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04012  ErbB signaling pathway
sfm04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108938597
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108938597
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108938597
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     108938597
Protein kinases [BR:sfm01001]
 Non-receptor tyrosine kinases
  ABL family
   108938597
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 108938597
NCBI-ProteinID: XP_018614814
LinkDB All DBs
Position
17
AA seq 1118 aa AA seqDB search
MGQQPGKFVGDQRRPSLPALHFIKGGKKESPRHGPSHCNVFVEHEALQKPDLEPQGLTEA
ARWNSKENLLAVPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTK
NGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSGINGSFLVRESESSPGQRSISL
RYEGRVYHYRINTASDGKLYVSSESRFTALAELVHHHSTVADGLITTLHYPAPKRNKPTV
YGVSPSYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLK
EAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTHGNLLDYLRECNREEVNAVVLLYMAT
QISSAMEYLEKKNFIHRDLAARNCLVGENQLVKVADFGLSRLMTGDTYTAHAGAKFPIKW
TAPESLAYNKFSIKSDVWAFGVLLWEIATYGLSPYPGIDLSQVYELLEKDYRMDRPEGCP
EKVYELMRACWKWNPAERPSFAEIHQAFETMFQESSISDEVEKELGKKGKKVTVCPMPQA
PELPTKTRTFRKNTDHKDGESANVVEPEVAVSPMLPRKERPYLDNNLNEDDRLLPKDKSR
TSIFISSLIKKKKKTAPAPPKRSSSFKGIDGPTERWGGAVCRGIGDAREDLISGPFLSDA
ASTFDPSKLLSAHNNGAGSTVNGPPGSPGPSGPFPPQHSRKKVNPMASTSGMRTLGEEDL
LSNSKRFHRSCSASSMPPGFDRTEWKSVTLPRNLQSSAHHFDSSTLGGRNDKPALPRKRA
SEQKPESVSRSGTLTPPPRLPKKTEDTVDDVFRDPESSPSCTPQNQMLKVSLQPPAHGEF
SKTSALQAELLKSSAFPVLGAAGEECRGRRPKNTPDSLVPKEKGKLQKSKPTPPLPSSSK
SGKASRSPTQDTPPDAKSKAFAQSFDHHHLSLTSAEQGKSLVSVESAKKSLTATSSKPPS
KTSPTSSMSTPPPGGPQSGSSNSEQTSTTAFIPLITTRQSLRKTRQTQERHPNSAITKEM
VLGGAEQLRAAIERNSEQTGSHNAVLEAGKNFSKYCVSYVESIQQMRNKFAFREAINKLE
SSLRELQICPTASGGAAAQQDFTKLLSSIKEISDIVQR
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcagccggggaagtttgtgggtgaccaaaggagaccgagcctgccggcgctg
cacttcatcaagggggggaagaaggagtctcctcggcatggaccatctcactgcaacgtg
tttgttgagcacgaggctctccagaagccagatttggagccccagggtttaacggaagca
gcacgttggaactccaaagagaacctgttggcagtgcccagtgaaaatgaccccaacttg
tttgttgcactgtatgactttgtggcaagtggggacaacaccctcagcatcactaaagga
gagaagctacgggtcttgggctacaaccacaatggggaatggtgcgaggcgcaaacaaaa
aatggtcagggttgggttcccagcaactatatcactccagtcaacagcctggagaagcac
agctggtatcatggccccgtgtctcgcagcgccgctgagtacctgctcagcagcggcatc
aatggcagcttcctggtgcgcgagagcgagagcagccctggccagagatccatctcgctg
cgctacgagggcagagtctaccactaccgcatcaacacagcctccgacggcaagctgtac
gtgtcgtcagagagccgcttcacagcgctggctgagctggtgcaccaccactcaacggtg
gctgacggcctgatcaccacactgcactacccagcccccaaacgcaataagcccactgtg
tatggagtctcgcccagctatgacaagtgggagatggagcgcaccgacatcactatgaag
cacaagttgggtggaggccagtatggggaggtctatgagggcgtctggaagaagtacagc
ttaacagtggccgtcaaaaccctcaaggaggataccatggaggtggaagaattcctgaag
gaggcagcagtcatgaaggagatcaagcatcctaacttggtgcaactgcttggtgtgtgc
acacgggagcctcccttctacatcatcacagagttcatgacccatggtaacctactggat
tacctgcgcgaatgcaatcgggaggaagtcaatgcagtggttctgctctatatggccaca
cagatctcttctgccatggagtacctggagaaaaagaacttcatccacagggacctggct
gcccgtaactgtttggttggggagaaccagttggtcaaggtggcagattttggcctgagt
cgtctaatgacaggagacacctacacagctcatgctggggccaaattccccatcaagtgg
acagcccctgagagcctggcctacaacaagttctctataaaatcagatgtatgggctttt
ggcgtactattgtgggagattgcgacatatggcctgtctccctacccgggtattgacctg
tcccaggtgtatgagctgctggagaaggactaccgcatggaccggcctgagggctgccca
gaaaaggtctatgaacttatgagagcctgctggaagtggaaccctgcagagcgtccatcg
tttgctgaaatccatcaagcatttgagaccatgttccaagaatcgagcatttcagatgag
gtagagaaggaactggggaagaaagggaagaaggtgaccgtgtgccccatgccacaggcc
cctgagctaccgaccaagaccagaaccttccgtaaaaacacagaccacaaggatggagag
agtgcaaatgtagtggagcctgaggtggctgtgtcacccatgcttcccaggaaggagagg
ccatacctggacaacaatcttaatgaggatgatcgccttttacctaaggacaaatcaagg
accagtatcttcattagcagtctcataaagaagaagaagaagaccgccccagcgcctcct
aagcgtagcagctctttcaaaggaattgatggacctacagagcgctggggaggagcagtg
tgtcgagggataggagatgccagagaagacttaattagtgggccttttcttagtgatgct
gccagcacctttgacccaagcaagcttctgagtgcccataacaatggtgcagggagcaca
gtcaatgggccacctggctccccaggaccctcaggtccattccccccacagcacagcagg
aagaaagtcaacccaatggcctccacttctggaatgagaactctgggtgaggaggacctt
ttatctaattcaaaacgcttccatcgttcctgctctgcctctagcatgccccctggcttt
gaccggactgagtggaagtcggtcacacttccccgcaacctgcaatcctctgcacatcac
tttgactcaagcacacttggaggacggaatgacaagccagcactgccgcgcaagagagct
agtgagcagaaaccagagtcagtttctcgctctggcacacttacaccgcccccaaggctc
cccaagaagaccgaagacacagtggacgacgtcttcagggatcctgagtccagcccaagt
tgcactccccagaaccagatgctcaaagtgagtcttcaaccaccggcacatggtgaattc
tctaaaacgagtgccttgcaggctgagcttctgaagtccagtgctttcccagtacttggg
gcagctggagaagagtgccgaggacgccgtccaaagaacacccctgatagcctggtgcct
aaagagaagggaaagcttcagaagtcaaaaccaaccccacctctgccttcctcttcaaaa
tctggaaaggcatctcggagtcctacccaggacacaccaccagatgccaaatccaaagcc
tttgcccagagctttgatcaccatcacctcagcttaactagtgctgaacaggggaagtcc
cttgtttcagtggaaagtgcaaaaaaaagtcttactgccacctcctccaaaccaccatca
aagacatctccaacatcctctatgtccaccccaccaccgggaggaccacagtctggatcc
tccaacagtgagcagacctctaccacagcattcatccccctcattacaactcggcagtct
ttacgcaaaactcggcagacccaggagaggcaccctaactcagccattacaaaggagatg
gtcttggggggagccgagcagctgcgtgctgccattgagaggaactcggagcagacaggc
agccacaatgccgtgcttgaggcaggaaagaacttctccaaatattgtgtcagctacgtg
gaatccatccagcaaatgaggaacaagtttgctttccgggaagccatcaacaagctggag
agcagtctgcgggagctgcagatatgcccgacagcttcaggtggcgctgccgcacagcag
gacttcaccaagctgctgtcttcaatcaaggagatcagtgacattgttcagaggtag

DBGET integrated database retrieval system