KEGG   Scleropages formosus (Asian bonytongue): 108938933Help
Entry
108938933         CDS       T04919                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like isoform X1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00590  Arachidonic acid metabolism
sfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108938933
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108938933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 108938933
NCBI-ProteinID: XP_018615461
UniProt: A0A1W5ARJ5
LinkDB All DBs
Position
Unknown
AA seq 631 aa AA seqDB search
MTCHTLRLWFVKGRTAASASTAASYLYTMKRPWARPLWRCVFCLLLMSVWSCCGDPGPTG
VTRTINPCCYYPCENWGVCMRFGIDGYQCDCTRTGYYGENCSIPELSTRFYLLFRPTPDM
VHYILTHFQWLWNIINRTFIQDWLMYKVLTVRSNLIPSPPTFNSKYDYVSWEAYSNVTYF
TRILPPVPKDCPLPLGTKGKAQLPDPQVVVDKFLLRRKFRPDPQGTNLMFAFFAQHFTHQ
FFKTHNRMGLGFTKALGHGVDAGHIYGDNLQRQLQLRLHKDGKLKYQVINGEVYPPSVKD
TPVNMSYPANIPAEQQLAIGQEVFGLLPGLGLYATLWLREHNRICDVLKAEHPTWDDEQL
FQTARLIVIGETIRIVIEEYVQHLSGYLLNLKFDPTMLFNTNFQYRNRIAVEFNQLYHWH
PLMPDSFLIDGDEIPYSQFTFNTTILTHYGVEKIVESLTLQIAGQIGGGHNFHPVVAKVA
VGVIKESRKLRLQPFNQYRKRFNLKPYTSFFELTGDKETAAELEELYGDIDGMEFYPALM
LEKTRPGAIFGESMVEMGAPFSLKGLLGNPICSPEYWKPSTFGGKTAFDIVNSATLKKLV
CLNTKWCPHVAFSVPPLRNNLPDQRKSSTEL
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgacttgccatactttgcgcctttggtttgtgaagggaaggactgctgcttcagcaagc
actgctgcgagttatttatatacgatgaagcgcccgtgggcccgtccgctgtggagatgc
gtgttctgcctgctgctgatgtcggtgtggtcgtgctgtggagacccgggacccacaggc
gtcacgagaaccataaacccctgctgctactacccttgcgaaaactggggtgtgtgcatg
aggtttggcattgatgggtaccagtgtgactgcactcgtacaggctactacggggaaaac
tgctccatccctgaattgtcaacaaggttctacctactcttcaggcccactccagatatg
gttcactacattctgacccatttccagtggctatggaacatcataaacagaacctttatc
caggactggctaatgtacaaggttctgacagtgaggtcaaacctgatcccgagcccacca
accttcaactctaaatacgactatgtgagctgggaagcctactccaatgttacctacttc
acccgaatcttgcctccagtgcctaaagactgtcccttgcccctgggcaccaaaggtaaa
gcccagcttccagatccccaggtggtggtggacaaattcctcctgaggaggaagttcaga
ccagaccctcaaggaaccaacctgatgtttgccttcttcgcgcagcacttcacccaccag
ttcttcaaaactcacaaccgcatgggactgggtttcaccaaggccctgggccatggtgtg
gatgcagggcacatttatggagacaacctgcagcgtcagctgcaactccggctgcacaaa
gatggaaagctgaagtatcaggtgattaatggtgaggtataccccccctcagtgaaggat
acacctgtgaacatgagctacccagcaaacattccagctgaacaacagctggccatcgga
caggaggtctttgggctgctccctgggctaggcctgtatgctactttgtggctacgtgag
cacaaccgtatctgtgatgtgctgaaggcagagcaccccacctgggatgatgagcagctc
ttccaaactgcccgccttattgttataggtgaaacaatacgcattgtgattgaggagtac
gtccaacacctgagcggctatctgctgaaccttaagtttgatcccaccatgctcttcaac
acaaacttccagtacaggaatcggattgctgtcgaatttaaccagctgtaccactggcac
ccactgatgcctgacagcttcctcatagacggagatgaaattccctactctcagttcacc
tttaacactactattttgacgcactatggtgtggagaagattgtggagtctttaacactt
cagattgccggacagatagggggtggtcacaacttccatccagtagtggcaaaggtggca
gtaggtgttatcaaagagtcaagaaaattgcgtctgcagcccttcaatcagtaccggaaa
agattcaacctgaaaccctatacgtccttctttgagttgacaggtgataaggagacagca
gcagagctggaggaactttatggcgacattgatggcatggagttctatcctgctctaatg
ctagagaagacacgaccaggtgccatatttggtgaaagcatggtggagatgggtgcacct
ttctctctgaaagggctcttgggaaaccctatatgctccccagagtactggaaacccagt
acatttggtggcaagaccgcttttgacattgtgaattctgccacccttaagaaactggtc
tgccttaataccaagtggtgtccacatgtggctttcagtgttccaccattaaggaataac
ctaccagaccaacgaaagtcatcgacagaattataa

DBGET integrated database retrieval system