KEGG   Scleropages formosus (Asian bonytongue): 108939092Help
Entry
108939092         CDS       T04919                                 

Gene name
dclre1b
Definition
(RefSeq) 5' exonuclease Apollo isoform X1
  KO
K15341  DNA cross-link repair 1B protein [EC:3.1.-.-]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108939092 (dclre1b)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     108939092 (dclre1b)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Nucleases
    108939092 (dclre1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DRMBL Lactamase_B_2 RMMBL DUF3446 Lactamase_B
Motif
Other DBs
NCBI-GeneID: 108939092
NCBI-ProteinID: XP_018615734
UniProt: A0A1W5AJ38
LinkDB All DBs
Position
19
AA seq 650 aa AA seqDB search
MVRFRGISVFCDNSDVVLRLCHSLHNLHYKSANSLSRCLGCVVWGEASGCLMPGCRSAGG
VQQQSDRAEAPPRAEMNGKVIPNTPLAVDYWHVRKCSHVRLFFLSHAHSDHTCGLTSTWA
NRPLYCSPISAKLLGLKLQVKEKWIHPLEVGEAHLLPLDDVGKETLTVTLMDANHCPGAV
MFLFQGYFGTILYTGDFRYTPTMLREPCLRSHTTIDVLYLDNTHCDPTRTLPSRQQATQQ
IKEIIRAHPGHDVVIGLCSLGKETLLIQLALEFRTWVEVSPQRMETLRTLELPDVFTTEP
GAGRIRVVDRSEVRAASLLAWNLQRPTLAILPTGRPVASFHPNIHVVPYSDHSSFRELED
FVSALRPASLVPIVGPCVPQLSSLISPRKQRYPVIVPQSVRNCMMRRLDPEPIFPTPLPK
VSRRTACGVVFESPQKTPCVSKADIIDLSEEMDISVDRDMDKPMKCCGNPVGKLCIEDVT
SLDTAPLLSADTDMSESCFLSQLSHSDWVFHPRVILQSKMLSLKPRLLRAPGSLPPVNEG
MSSARKGRDSTSSTTCSSSHSSHIFSAAPAFSTSELSLDPELVLLAELLTFPREDLYGSY
TLVKQAFQDGHRLAPVCPVQLGSSAFHSTVEHFLSLQAGGTAPAQVSATH
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggttcgttttcgtggaatttcagtattctgtgataattcggatgtagtcttgcgactt
tgtcattcgctgcataatcttcactacaagtctgctaacagcctttcacgctgcttaggc
tgtgttgtttggggtgaggcttcaggctgcttgatgcctggctgccgcagtgccgggggg
gtccagcagcagagtgaccgtgcagaagcccccccccgcgcggagatgaacggaaaggtg
attcccaacacgcccctggctgtggactactggcacgtgcgcaagtgcagtcacgtgcgc
ctcttcttcctgtcgcacgcgcacagtgaccacacgtgcggcctgacgtctacgtgggcc
aaccggccactgtactgctccccgatcagtgccaaactgctcggactgaaactgcaggtg
aaggagaaatggatccaccctctcgaggtgggagaggcgcaccttcttccattggacgac
gtgggcaaggagacgctcactgtcacgctgatggatgccaatcactgtccaggggccgtc
atgttcctctttcagggctactttggcaccatcctctacacaggggactttcgctataca
cctaccatgcttcgcgagccctgtctcaggtcccacactaccattgatgtcctgtacctc
gacaacacccactgtgaccccacccgcacacttccctcccgtcagcaagccactcagcaa
atcaaagagatcatccgtgcgcatccaggacacgatgtggtcattggcctgtgttccctg
ggcaaggaaactcttctgatacaactggcactggagttccgcacatgggtggaagtgagc
ccccagaggatggagacactgcggactctggagctgccagacgtcttcaccaccgaacct
ggtgccggccgcatccgagtggtggatcggtctgaggtgcgagctgccagcctgctggca
tggaacctgcagcgccccacattggccatcctgcccaccggccgacccgtggcatctttc
caccccaacatccatgtggtgccctactcggaccactcctccttccgggagctggaagac
tttgtctctgccctgcgccctgcctctctggtgcccattgtgggcccatgtgtccctcag
ctctcctccctcatctccccacgcaaacagaggtaccctgttattgtgcctcagtctgtc
cgcaactgtatgatgagaaggctggacccagagcccattttcccaacccccttgcccaag
gtcagtaggcgtaccgcctgtggtgtggtgtttgagtccccccaaaagacaccttgtgtt
tccaaggctgacatcatagacctctctgaggaaatggacattagtgtagacagggatatg
gacaaacccatgaaatgctgcggaaaccctgttgggaagctgtgtattgaagatgtgacg
tcccttgatacagcccctctgctgtcagcagatacggacatgtctgagagttgctttctc
agccagctgagccatagcgactgggtatttcatcccagggtaatcctgcagagtaaaatg
ctgtctttgaaacccaggctcctgagagcccctggctctttaccaccagttaatgaaggc
atgtcttctgcgaggaaaggcagagactccacttcctcaaccacatgcagtagcagtcac
tccagtcatattttttctgcagcacctgccttctccacttctgagctgtcacttgaccca
gagttagtcctgctagcggagctcctcacctttcccagagaggacctttatggtagctac
actcttgtgaagcaggccttccaggatgggcaccgcctggctcctgtgtgccccgtccag
ctaggctcctctgctttccacagtaccgtagagcacttcctcagcctgcaggcagggggc
actgcccctgcacaggtgtcagccactcactga

DBGET integrated database retrieval system