KEGG   Scleropages formosus (Asian bonytongue): 108939127
Entry
108939127         CDS       T04919                                 

Gene name
nthl1
Definition
(RefSeq) endonuclease III-like protein 1
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108939127 (nthl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108939127 (nthl1)
Enzymes [BR:sfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     108939127 (nthl1)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     108939127 (nthl1)
 Prokaryotic type
     108939127 (nthl1)
SSDB
Motif
Pfam: HhH-GPD HHH
Other DBs
NCBI-GeneID: 108939127
NCBI-ProteinID: XP_018615781
LinkDB
Position
2
AA seq 417 aa
MSSPYFIGKSSASVLSRSARRGVRTRAVGSKGAELTKRGDLEKEAEDHAKGAVKQESEER
SIAEPDRRFQRTGGKQLLPVLEATGRSGSRTEGMRSCGAPPRRGHVKVQYEESDPKKERR
EPPDWRRQLDNIREMRSRRDAPVDHMGAEKCYDSHASPEVGRYHVLVSLMLSSQTKDHVT
AAAMRKLREHGLTVESVLRMDDDTLGKLIYPVGFWRTKVKYIKQTAAILQDEYGGDIPDS
FEGLVRLPGVGPKMAHLAMDIAWNRVSGIGVDTHVHRISNRLGWTRTQTKTPEDTRRELE
DWLPRELWSEINWLLVGFGQQVCLPLSPRCSECLNEHRCPSAHHSSPGKKLKLSPSKTPR
GKTRVWVDSPRPSHAIKVEKALPADPPTERRRTRASAAVAPRESTVGLSIKPDPDAP
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtcctcgccgtacttcatcgggaagagcagcgcgagtgtgctgagccggagcgcgcgc
agaggcgtccgcaccagggctgtgggttcgaagggcgccgaactcacaaagcgtggagac
ctcgagaaggaggcggaggatcatgcgaagggagcagtgaagcaggagagtgaggagcgc
agcatcgcagagccggatcggcgcttccagagaacgggtggaaaacagctgttgccagtg
ttggaagcgactgggaggtcaggcagcaggacggaggggatgcgaagctgcggggccccc
cccaggagaggtcacgtgaaggtgcagtatgaggagagcgatcccaaaaaggagcggcgg
gagcctcccgactggaggaggcagctggacaacatccgggagatgaggagccgcagagac
gcccccgttgaccacatgggagcggaaaagtgctacgactcccacgcttctcccgaggtg
ggacgctatcatgtgctagtttccctcatgctgtccagccagaccaaggaccacgtgacg
gcagcggccatgcggaagctcagggaacacgggctgacggtggagagcgtgctgaggatg
gacgacgacacgctggggaaactcatctacccagtgggcttttggaggaccaaggtgaag
tacatcaagcagaccgcggccatcctgcaagacgagtacggcggcgacattccagacagc
ttcgaggggcttgtacgcctcccgggggtcgggcccaaaatggctcacctggccatggac
atcgcctggaatcgcgtgtccggaatcggtgtggacacacatgtgcaccgcatctccaat
cggctgggctggacgaggacccagaccaagacccctgaagacacccggcgggagctggaa
gactggctgcccagggagctctggagtgagatcaactggctgctggtgggcttcggccag
caggtctgtctgccgctgagcccccggtgctccgagtgcctcaacgagcaccgctgcccg
tcagcccatcattcctccccgggcaaaaagctcaagctgagccctagcaagacccccaga
gggaagacgagggtttgggtggactctcctcggccttcgcacgccatcaaagtcgaaaag
gccctgcctgcagaccccccgactgaaagacggaggaccagagccagtgccgctgtcgcg
cctagagaaagcaccgtggggctctccattaagccagatcctgatgctccttga

DBGET integrated database retrieval system