KEGG   Scleropages formosus (Asian bonytongue): 108939210Help
Entry
108939210         CDS       T04919                                 

Gene name
ube2t
Definition
(RefSeq) ubiquitin-conjugating enzyme E2 T
  KO
K13960  ubiquitin-conjugating enzyme E2 T [EC:2.3.2.23]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    108939210 (ube2t)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sfm04121]
    108939210 (ube2t)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108939210 (ube2t)
Enzymes [BR:sfm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     108939210 (ube2t)
Ubiquitin system [BR:sfm04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   108939210 (ube2t)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     108939210 (ube2t)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con UEV Prok-E2_B RWD
Motif
Other DBs
NCBI-GeneID: 108939210
NCBI-ProteinID: XP_018615878
UniProt: A0A1W5AQR1
LinkDB All DBs
Position
19
AA seq 192 aa AA seqDB search
MQRNSRLKRELQLLSTEPPPGVSCWQSDDNTGELKAQIVGGVDTPYEGGVFTLEITIPER
YPFEPPKIRFLTPIYHPNIDNGGRICLDALKLPPKGAWRPSLNISTVLSSIQLLMAEPNP
DDPLMADISSEYKYNRHVFLEKAKRWTEKHAMQQTKEMGEMDTENKRTKSAVLSHKREAL
SSEVQNSKKTCF
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggaacagtaggttgaagcgggagctgcagctgctgagcaccgagccgccgccg
ggggtatcctgttggcagagcgacgacaacaccggggagctgaaggcgcaaatagtgggt
ggtgtggacactccttatgaaggtggtgtgtttactcttgagataactatcccggaaagg
tatccctttgaacctccaaaaattcggttcctcacaccgatctatcaccccaatattgac
aatggtggacgtatctgtcttgatgctctcaaattaccaccaaagggagcctggagacct
tccctcaacatctccactgtgctttcctccatccagctgctcatggctgagcctaatcct
gatgaccctctcatggcagacatttcttcagaatacaaatacaataggcatgtatttctg
gagaaggcaaagaggtggactgagaaacatgccatgcaacagaccaaggagatgggagaa
atggatacagagaacaagcggactaaatcggcagtgctatcacacaagagggaagcacta
agctcagaagtgcagaactcaaagaagacatgcttctag

DBGET integrated database retrieval system