KEGG   Scleropages formosus (Asian bonytongue): 108939396Help
Entry
108939396         CDS       T04919                                 

Gene name
tti1
Definition
(RefSeq) TELO2-interacting protein 1 homolog
  KO
K20403  TELO2-interacting protein 1
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    108939396 (tti1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108939396 (tti1)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  Check point factors
   Triple T complex
    108939396 (tti1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dopey_N VHS RTP1_C1 HEAT DUF347
Motif
Other DBs
NCBI-GeneID: 108939396
NCBI-ProteinID: XP_018616226
UniProt: A0A1W5ATR3
LinkDB All DBs
Position
19
AA seq 1098 aa AA seqDB search
MPQTCSKEVCYACVRQKRLTSAGNLHFRRMSQIDNAKVAFAFLRPACVLLTREQSIQNVQ
QLNAQLREVSDLALQQLQEYVLFPLRFVLKTPGSKRENLIQAVVEGIEYVLSNTCVHSWD
LLQELFSELCLCLSSPGKPGKPASVSEDLKAAVIQSLDALLHAAYGDIALQLYKPVMLPG
LGAAISLLLALAEEEKSRKVQAAALKCLLILLLQCDCKEPHLWVGQEESCALATAFACFL
PGITQVLTRVITGDMKQGHAVTVKAIKVWYRTVGLVMADEQLSNADSSEASAADLGKVGE
LLVKRTQTWVKETSEKVAILLKRITSCVSVHQHWKVRLEMVNLSENLLSTCQKSLKQCIS
NLLEVLVGKLNDENSAVRDKCSAALEAIALRNQTGDNHTFNDILSENLHSLATSLPRLMR
ISDDQHKLFILNVFLGYLKVLGPKVAMVLNSAAHLQRISKALMQVLELDITDVRIVEERS
SSSLEHTGLGPHELYTQKKHFVYFTDANIFSSLQQICRFLGYYGNLYLLVDHFMDLYRES
SVYRKQCALVLNEIISGAAGVGLVAKHKYGPVSKDDLKAAVMSIIEEYTSLNNWHLPTNS
VESDRDEDSHFSHLRILSITNSVQENHNQLLPAKKSSTVHQMNSNIWQICIQLEGIGCFA
VALGVDFRLLLMTTLYPVLEKAGDETLLISHSALCSLWDICRACGYSSLKELINMNSDYL
LNDISLNLQRLSLHPHAPRVLAVMFYHSDASLLPLVGDVVQDVLTALDLSYDERAPVFCA
VLHSLVKALVRWFPAKLGEKKYSAPAGARCEDPLDVRQFLLDYHKLRCQAEGLLEDEGDT
GDIEKPSTVPDSDEDLEDPDKKPELPSHITMAKDVLERCIHLLSDPSLRLRLKVLDVLEL
CVCVLQSHEDVLLPLVHRCWPALLQRLTNDDPLAVLWAIKVLCTLGETCGDFLRKRVSQE
VLPRLTGSLLKQAPLSAKAGPIYAHTLAFKLQLAVLEGLGTLCLRLDLADSDLDLVSEAC
LPYLSCRQPARLQEACLSVFRHLIKVDPDAVWFMLNELYCPRSYEPPHSDLHAVRLAGMG
RPKNEYTDNILRLLAEIH
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagacatgttcgaaagaagtctgttatgcctgtgtgcggcagaagaggctgaca
tccgctggtaacctccacttcagaaggatgtcgcagattgataatgcaaaagtggcgttt
gccttcctgcggccggcatgcgtgctgttgacccgggagcagagcatacagaatgttcag
caacttaacgcgcagctcagggaggtgagtgacctggcgttacagcaacttcaggagtat
gtcctcttcccgctgcgtttcgttctcaagacacccggttccaagagggagaacctcatt
caagcggtggtggagggcattgagtatgtcctgagcaacacctgcgtgcacagctgggac
ttactacaggagctcttttctgagctttgtttgtgcctcagctctccaggaaagccaggg
aagcctgcatctgtctcagaggacttgaaggctgcagtgatacaaagtttggatgcgctg
ctgcatgcggcttatggagatattgcattacaattgtacaaaccagtcatgttgcctggc
ttgggtgcagctatttcccttctgctggccctagctgaggaggagaaatctaggaaggta
caggccgctgccttaaagtgtctcctcatcctgcttttgcagtgtgattgcaaagaacca
catctgtgggtgggccaagaggagagctgtgctcttgctactgcttttgcttgtttctta
cctggaatcacccaagtcctcacacgggtaattactggtgacatgaagcagggacatgct
gttactgtcaaggccataaaggtctggtacaggaccgtaggactcgtcatggcagatgag
cagctgtcaaatgctgattccagtgaggcatcggcagcggacctgggtaaggttggggaa
ttgttggtgaagaggacacagacctgggtgaaggagacatcagaaaaggtggctatactg
ctgaagaggataacatcttgcgtgtcagttcaccagcactggaaggtgagacttgagatg
gtcaacctctcagaaaaccttctttccacctgccaaaaatccttaaagcagtgcatcagc
aatcttttggaagttctggtgggcaagctgaatgatgagaactcggctgtccgagataag
tgcagtgctgctctagaggccatagcactgagaaatcaaactggagataaccacaccttc
aatgatatcctttcagagaaccttcactccctagccacgtctctgccacgtctcatgagg
atatcggatgatcagcacaagctgttcatcctcaacgtctttttaggctacctcaaggtc
cttggacccaaggtggctatggtgctgaactcagcagctcacttgcagcgcatctccaag
gccttgatgcaggtgctagagctagatatcacagatgttcgcatagttgaagagaggagc
tcatcttccttggagcacacaggccttggacctcatgagttgtacacccagaagaagcat
ttcgtgtacttcacagatgcaaacattttctcctcgctgcagcagatctgcaggtttttg
ggctactatggaaacctctatttgctagtggatcatttcatggatctctatagggaatcc
tcagtttacagaaagcagtgtgctttagttcttaatgagattattagtggtgcagctgga
gtggggcttgtggcaaaacacaagtatggcccagtaagtaaggatgatcttaaagcagca
gtcatgtccatcattgaagaatacactagcctgaacaactggcaccttcctaccaacagt
gtggaatctgaccgggatgaagacagtcatttcagtcatttgagaattctctccattact
aatagtgttcaagagaaccataaccagctgctccctgcaaaaaagagctccactgttcac
cagatgaacagcaacatctggcagatctgcatccagctggaaggcataggttgctttgct
gttgccctaggggtagacttccggttgcttctgatgacaaccctgtacccagtgctggag
aaggctggcgacgagaccctgctgatcagccactcagctctgtgttccttgtgggacatt
tgccgggcatgtggttacagctcattgaaggagcttatcaacatgaactctgactacctg
ctcaacgacatctccctgaatctgcagaggcttagcttgcaccctcatgctccacgggtg
cttgccgtcatgttctaccactccgatgccagcctgctgcccctagtaggggatgttgtc
caagatgtgctcacagctctggacctgagctatgacgagagggcaccagtgttttgtgca
gtgctgcattcactggtaaaggctttagtgcgatggttccccgctaagttgggggaaaag
aaatacagtgctccagctggggccagatgtgaagaccctctcgatgtgaggcagtttctt
ctggactaccacaaattgagatgccaggctgagggcctcttggaggatgaaggagacaca
ggtgacatagaaaaaccatcgactgttccagactctgacgaggatctagaagatcccgat
aaaaagcccgaactcccctctcacatcacaatggctaaagatgtgctggagcgatgcatc
cacctgctgtctgatcccagccttcgtctcagacttaaggtcctggatgtgctggagctg
tgtgtgtgtgtgctgcagagtcatgaggatgtgctactgcccttagtacaccgatgttgg
cctgccctcctgcagcggctcaccaatgatgacccgttggctgtgctctgggccatcaag
gtgctgtgcactctgggtgagacatgtggagacttccttaggaagagagtctcccaggag
gtgctgccaaggctcacaggctccctgctgaagcaggccccactgagcgccaaggccggg
cccatctacgcccacaccttggccttcaagcttcagctggccgtcctggaaggcctggga
actctgtgtctcagactggacctggcggactctgacctggacctggtgtctgaggcttgc
ctgccctacctgagctgcagacagccagctagacttcaggaagcctgcctgagtgttttc
cgccatctcatcaaggtggaccctgatgcagtttggttcatgctgaacgagctctactgt
ccacgttcatatgagcctccgcactcggacttgcacgccgtgcgcctggctgggatgggc
cgaccgaagaacgagtacaccgacaacatccttaggctcctggcagagatccattga

DBGET integrated database retrieval system