KEGG   Scleropages formosus (Asian bonytongue): 108939490Help
Entry
108939490         CDS       T04919                                 

Definition
(RefSeq) transcription factor PU.1-like isoform X1
  KO
K09438  transcription factor PU.1
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sfm03000]
    108939490
Transcription factors [BR:sfm03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    108939490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 108939490
NCBI-ProteinID: XP_018616396
UniProt: A0A1W5AU58
LinkDB All DBs
Position
2
AA seq 270 aa AA seqDB search
MQHSSRMERFLISPPSDEMIAYDPDMYRMPMEYPPYLSSDGESHGDHGWDYYNHAIHTAD
FENLQESHFTELQNVPALHLTGLHRIGDLEPLHPLDSGINGHHLTMPPQIPYLPHPLCFP
NPSSAERSSDEEEHGTRSPPLEVSEGEEDFGDHHPCPSAMEAGNKKKIRLYQFLLDLLRN
GDMKDSIWWVDKDKGTFQFSSKHKEALANRWGMQKGNRKTMTYQKMARALRNYGKTGEVK
KVKKKLTYQFSGEVMGRSVGPAERKVYPLS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacagcagcaggatggagaggttccttatctcacctccatcagatgaaatgata
gcttacgatccagacatgtatcgaatgccaatggagtatcctccatatctcagcagtgac
ggagaaagtcacggagatcacggatgggattactacaaccatgccattcacactgcagac
tttgagaaccttcaggaaagccacttcacagagctccagaatgtccctgcccttcacctc
actggcctccatcggattggggacttggagcctctgcatcccctggactcagggattaat
gggcatcacctgaccatgcctccgcagatcccatacttgccccaccctctttgttttccc
aacccctcctctgcagagcgcagctctgacgaggaagagcatgggacacgaagccccccc
cttgaggtgtccgaaggagaggaggacttcggggatcaccacccctgtccctctgccatg
gaggctggaaacaagaagaagatacgcttgtaccaattcctgctagaccttctccggaat
ggagacatgaaggacagcatctggtgggtggacaaggacaaaggcacctttcagttctcc
tctaagcacaaagaggccctggccaaccgttggggcatgcagaaagggaaccgcaagacg
atgacctaccagaagatggcccgggcactgcggaactacggaaagacgggggaggtgaag
aaggtgaagaagaagctaacgtaccagttcagtggagaggtgatggggagaagtgttggg
cctgcagagaggaaggtgtacccattatcatag

DBGET integrated database retrieval system