KEGG   Scleropages formosus (Asian bonytongue): 108939617Help
Entry
108939617         CDS       T04919                                 

Gene name
c8g
Definition
(RefSeq) complement component C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
sfm  Scleropages formosus (Asian bonytongue)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin VDE ApoM
Motif
Other DBs
NCBI-GeneID: 108939617
NCBI-ProteinID: XP_018616577
UniProt: A0A1W5ALQ3
LinkDB All DBs
Position
24
AA seq 206 aa AA seqDB search
MRAPWLYVSVTILLGFLLEPVGAAKGQRRGRRPPKQQPIDKIPAVQNLNLEQLNGKWFLI
SVASKCQYLQENNFRVESTTMTLSSPSSRTSPLLVDTLRKLNQQCLNIRQEYQQTGSSGR
FVLKGHSTDINIVVAETDYNSYAILYYQKQDQITMKLYGRSTQLPDSIMDKFEQLAEKQN
IKIDNVYPFPKYGFCMTADKQLQLGL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccccgtggctgtacgtatctgtcacgatactgctaggattccttctggagcca
gtgggggctgccaagggacagcggaggggacgacgtccaccaaaacagcagccaattgac
aagattcccgctgtgcaaaatcttaacctggagcagttaaacggcaagtggttcttgatc
agtgttgcatcaaagtgtcagtacctccaagaaaacaacttccgagttgaaagtaccacg
atgacgctgagttccccctcctctcgtacctctcctcttctcgtggacactctgaggaag
ctgaaccagcagtgcttgaacatcagacaggaataccagcagactggtagcagcggccgc
ttcgtgctgaaaggccactcaaccgatataaacattgtggttgcagagacagactacaac
tcctacgccatcctgtactatcagaaacaagaccagatcaccatgaagctttacgggagg
tccacgcagttgcctgacagtatcatggacaagtttgaacaacttgctgaaaaacagaat
ataaaaattgacaatgtttatccttttcccaaatatgggttctgcatgacggcagacaaa
cagctgcaactcggcctataa

DBGET integrated database retrieval system