KEGG   Scleropages formosus (Asian bonytongue): 108939682Help
Entry
108939682         CDS       T04919                                 

Gene name
pola1
Definition
(RefSeq) DNA polymerase alpha catalytic subunit isoform X1
  KO
K02320  DNA polymerase alpha subunit A [EC:2.7.7.7]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03030  DNA replication
Module
sfm_M00261  DNA polymerase alpha / primase complex
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108939682 (pola1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108939682 (pola1)
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     108939682 (pola1)
DNA replication proteins [BR:sfm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    108939682 (pola1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B zf-DNA_Pol DNA_pol_B_exo1 DNA_pol_alpha_N DUF1744 DNA_pol_B_2
Motif
Other DBs
NCBI-GeneID: 108939682
NCBI-ProteinID: XP_018616727
UniProt: A0A1W5AM56
LinkDB All DBs
Position
24
AA seq 1481 aa AA seqDB search
MAPVSSADKGVEGGDGDAGGAAGDACGLAVSRSRRERKDKAGRKAALEQLKKAMKGEKVK
YEVEELTSVYEEVDEEQYSRMVRERRDDDWIIDDDGTGYVEDGREIFDEDLEDDAPDAGA
KGKGAGKGPGSKDKKVSRKPVVSKSSSIKSMFMASSAKKAAEKDVDLSSDALLGDILHDL
HSEKPPVVTPPPVVALRKKKVTGNPMNPFSVKPRTPKMSVHVCVREGGPSAVVLKEQLVA
PSARTSAETPSAEPPDSAGSRKAGVMAEESEQAEDHGALQFDEGDFDEPMEVGGDGGGTE
AVVEPEVEPNRHAHDLLLPLNALGSSCWDDGVDSERSDPAVLEVQVDSSHLPLVEGPDGD
TVFRFYWLDAFEDQYSQPGVVFLFGKVWIDSAKAHVSCCVAVKNVERVVYLLPRELKMNL
ATGKETETPVSMMDVYQEFSDLSEKFRIFKFKSKKVQKSYAFEIPDVPSQSEYLEVRYSA
EMPQLPSDLKGATFSHVFGTNTSCLEHLLLSRKIRGPCWLDIRTPQPSSQSMSWCKVEAV
AQRSALIDVVRDLPPPPLVVMAISMKTVQNNRTHHNEVVSLAALVHHRFPLDKAPPRPPY
QTHFCVVSKPSDCIFPYDFKDAVRRKNGAVEIAATERTLLGFFLAKMHKIDPDVIVGHDI
YGFDLEVLLQRISVCKVPHWSKMGRLRRSNMPKLGGRGAFAERNATAGRVVCDVEISAKE
LIRCRSYHLSELVAQVLKAERVSVPQESLRNLYSDSAHLLHLLELTWMDAKFVLHIMCEL
NVLPLALQITNIAGNILSRTLMGGRAERNEYLLLHAFHEKDFIVPDKALFKRPLQDPLQE
DEDMETGKGKSRKARRKAAYTGGLVLDPAVGFYDKFVLLLDFNSLYPSIIQEFNICFTTV
TRSSAEQADDPDEIPELPEPDLEMGILPREIRKLVERRRQVKQLMKQPDLNPDLYLQYDI
RQKALKLTANSMYGCLGFSYSRFYAKPLAALVTHKGREILMHTKDMVQKMNLEVIYGDTD
SIMINTNSTDLEEVYRLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALVVEPTA
DGRYSTKQELKGLDIVRRDWCDLAKACGNYVIGQILSDQNRDAIVENIQKHLLEVGEKVL
NGSVPLAQFEIHKALTKDPQDYPDKKSLAHVHVALWINSQGGRKVKAGDTVSYVICQDGS
NLSPSQRAYAPEQLQKQEGLSLDTQYYLSQQVHPVVCRICEPIEGIDAVLIATWLGLDPS
QFRAHQQHRREEEGDGLPGGPAQLTDEERFRDCERFHFACPQCGTQNIYDSVFEGAGLSL
EPSLSTCCHVPCSGHPVQHSVHIANKLVLDIRRFIRRYYSAWLLCEDPACQNRTRRLPLA
FSRSGPICPACTKTTLRPEYSEKALYNQLCFYRFVFDWEYAVNKVLPPEERGYFKTKWKN
RWAEEKEVYGKLKEVADRALASSSYSEVNLGKLFETFVSVK
NT seq 4446 nt NT seq  +upstreamnt  +downstreamnt
atggctccggtttccagcgcggacaaaggtgtggagggcggagacggcgatgccggcggc
gctgctggagatgcctgtggcctcgcggtgtcccgctcgcggagggagaggaaggacaag
gcggggcgcaaggctgccctggagcagctcaagaaggccatgaagggggagaaggtcaag
tacgaggtcgaggagctgacgagcgtctacgaggaggtggacgaggagcagtactcccgc
atggtccgcgagcggcgggatgacgactggatcatcgacgacgacggaacgggttacgtg
gaggacggaagggagattttcgacgaggaccttgaggacgacgcgccggatgcgggtgcg
aaaggtaaaggggctggcaaagggccgggttccaaggataaaaaggtgtccaggaagcct
gtcgtcagcaaatccagcagcatcaagagcatgttcatggccagcagcgcgaagaaagct
gcggagaaggacgtggacctgtcgagcgacgctctgctgggggacatcctgcatgacttg
cactcagaaaaaccacccgtcgtcacacccccgccagtcgtcgctctccgcaagaagaag
gttactgggaaccccatgaatccgttttccgtcaaaccccggactcctaagatgtctgta
catgtatgtgtccgtgagggaggtccttctgcagtggtgttgaaagagcaactagttgct
ccttcagccaggacatctgctgaaaccccctcagccgaaccccctgactcagcgggcagc
aggaaggctggcgtgatggcggaggaatccgagcaagccgaggaccacggtgccctgcag
tttgatgaaggtgactttgacgagcccatggaggtgggtggcgacggaggcggtacggag
gctgtggtggaacccgaagtagaaccgaaccgtcacgcccacgatctcctgttgcccctg
aacgcgttgggctcctcctgctgggacgatggggtagacagtgagagaagcgaccctgcg
gtgctggaagtgcaggtggactccagccacttgccgctcgtggaggggcccgacggggac
acggtgttccgcttctattggctggacgccttcgaggaccagtacagtcagcctggcgtg
gtcttcctcttcggcaaggtgtggattgactcggcgaaggcgcacgtcagctgctgcgta
gcggtgaagaatgttgagagggtcgtgtacctgctgccccgggagctcaaaatgaacctg
gcgacgggcaaggagacagagactcctgtcagcatgatggacgtgtaccaggagttcagt
gacctctcggagaagttcaggatcttcaagttcaagtctaagaaagtacagaagagctac
gcctttgagattccagacgttccatcacagtccgagtacctggaagtgcgctactcggct
gagatgcctcagctgccctcggacctgaagggggcgacgttctcccacgtgttcggtacc
aacacctcctgtctggagcacctgctgctgagtcggaagatccgtgggccctgttggctc
gacatcagaaccccccagccaagcagccagtccatgagctggtgcaaggtggaggctgtg
gctcagaggagcgcccttatagacgtggtgcgggacctgcccccccctccgcttgtggtc
atggccatcagcatgaagaccgtgcagaacaacaggactcatcacaacgaggttgtgtcc
cttgcagcactcgtccaccacaggttccccctggataaagcacctccaagacctccctac
cagactcacttctgtgtggtgagcaaaccgagcgactgcattttcccttatgacttcaag
gatgccgtgcgcagaaagaacggcgctgtggaaatagccgccactgagcgcaccctgctg
ggcttcttcctcgccaagatgcacaagattgaccctgacgtcattgtgggacacgacatc
tacggattcgacctggaagtgcttctgcagaggatcagcgtgtgcaaggtgccccactgg
tccaagatgggtcgcctgcgcaggtcaaacatgcccaagttggggggccgcggcgccttc
gccgagaggaacgccaccgctggccgcgtcgtttgtgacgtggagatctcggcgaaggag
ctcatccgctgccgtagctatcacctgtccgagctcgtggcccaggtgctgaaggccgag
agggtctcggtgccccaggagagccttcggaacctgtacagcgactcagctcacctgctc
cacctgctggagctcacttggatggatgccaagttcgtcctgcacatcatgtgtgagctg
aacgtcctcccactggcgctgcagatcaccaacattgccggaaacatcctgtctcgaacc
ctgatgggaggtcgtgcagagaggaacgagtacctgctgctgcatgccttccatgagaag
gacttcatcgttccggacaaagcgctctttaagaggcccctgcaggacccgctgcaggaa
gacgaggatatggagacgggcaaagggaagtcgcggaaggcgcggaggaaggcggcatac
actggggggctggtgctcgaccctgctgtcggcttctacgacaagtttgtcttgctgctg
gacttcaacagcctgtacccttccatcatccaggagttcaacatttgcttcaccaccgtc
actcgcagcagtgccgagcaggccgacgacccagatgagatccccgagcttccggaacca
gacctggaaatggggatcctgcccagggagatccggaagctggtggagcggagacgacag
gtcaaacagctgatgaagcagccggacctgaaccctgacctctacctacagtatgacatc
cgccagaaggccctgaagctcacggccaacagcatgtatggctgcctgggattctcgtac
agccgcttctacgccaagccgctcgctgccctggtgacccacaaggggcgtgagatcttg
atgcacaccaaagacatggtacagaagatgaacctcgaggtcatctatggtgacacggac
tcgattatgatcaacaccaacagcaccgatctggaggaggtctaccggctgggtaacaag
gtgaagagcgaggtgaacaagctgtacaaacttcttgagatcgacattgatggagtgttc
aagtctctgcttctactgaagaagaagaagtatgcagctctagtggtggaaccaactgcc
gacggtcgctacagcaccaagcaggagctcaagggcctagacatcgtgcgccgggactgg
tgtgatctcgccaaggcctgcggcaactacgtaattgggcagatcttgtcggatcagaac
cgagacgccatcgtagagaacatccagaagcacctgctggaggtgggggagaaggttttg
aatggcagtgtgccgctcgcacagtttgagatccacaaggccctgaccaaggaccctcag
gactacccagacaagaagagcctagcccatgtccatgtggccctgtggatcaactcccag
gggggccgcaaggtcaaggcaggggacacggtgtcctacgtcatctgccaggatggctcc
aacctgagccccagccagcgtgcctatgccccagagcagctgcagaaacaggaaggcctg
agcctggatacacagtactacttgtcccagcaggttcatccagttgtgtgcaggatctgc
gagcccatagagggcatcgatgccgtgctcattgccacctggctcggtttagacccctcc
cagttccgtgctcaccagcagcaccggagggaggaggaaggcgacgggctgccagggggc
cctgcccagctcaccgacgaggaacgattccgagactgcgagcgcttccactttgcctgc
ccgcagtgcggaacccagaacatctacgattccgtgttcgagggagcgggattgtcgctg
gagccgagcctttcaacctgctgccacgtcccatgttcaggccaccctgtccaacactcg
gtccacatcgccaacaagctcgtgctggacattcgacgcttcatccggagatattatagc
gcatggctgctgtgtgaggatccagcgtgccagaaccgcacccggcgcctgcctctggcc
ttctcgcgctcggggcccatctgccctgcctgcaccaagacgactctgcgtcccgagtac
tcggagaaggccctttacaaccagctctgcttctaccgcttcgtcttcgactgggagtac
gcggtcaacaaggtgctgccgcccgaagaaaggggctatttcaaaaccaagtggaagaac
cgctgggcagaggagaaggaggtgtatgggaagctgaaggaggttgccgaccgtgccttg
gcctccagcagctattcagaggtgaaccttggcaaactgttcgagaccttcgtctcggtg
aagtag

DBGET integrated database retrieval system