KEGG   Scleropages formosus (Asian bonytongue): 108939944Help
Entry
108939944         CDS       T04919                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase RBX1-like
  KO
K03868  RING-box protein 1 [EC:2.3.2.32]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03420  Nucleotide excision repair
sfm04110  Cell cycle
sfm04114  Oocyte meiosis
sfm04120  Ubiquitin mediated proteolysis
sfm04141  Protein processing in endoplasmic reticulum
sfm04310  Wnt signaling pathway
sfm04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108939944
   04120 Ubiquitin mediated proteolysis
    108939944
  09124 Replication and repair
   03420 Nucleotide excision repair
    108939944
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108939944
   04350 TGF-beta signaling pathway
    108939944
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108939944
   04114 Oocyte meiosis
    108939944
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sfm04121]
    108939944
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108939944
Enzymes [BR:sfm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     108939944
Ubiquitin system [BR:sfm04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   108939944
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     108939944
   ECV complex
     108939944
   Cul3 complex
     108939944
   Cul4 complex
     108939944
   Cul7 complex
     108939944
   Cul9 complex
     108939944
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      108939944
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      108939944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3
Motif
Other DBs
NCBI-GeneID: 108939944
NCBI-ProteinID: XP_018617154
UniProt: A0A1W5ANE2
LinkDB All DBs
Position
20
AA seq 108 aa AA seqDB search
MAAAMDVDSPSGANSGSSKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggcgatggatgtggactccccgagcggagccaacagtggctcaagcaaaaag
cgctttgaagttaagaagtggaacgccgtggcgctctgggcctgggacatcgtcgttgac
aactgtgccatttgccggaaccacatcatggacctctgcattgagtgtcaagccaatcaa
gcctcagccacaagtgaggaatgcaccgtagcgtggggagtgtgcaatcatgcttttcat
ttccactgcatctctcgctggctgaaaaccaggcaagtgtgtccactggacaacagagaa
tgggagtttcagaagtatgggcactag

DBGET integrated database retrieval system