KEGG   Scleropages formosus (Asian bonytongue): 108940038Help
Entry
108940038         CDS       T04919                                 

Gene name
ten1
Definition
(RefSeq) CST complex subunit TEN1 isoform X1
  KO
K23313  CST complex subunit TEN1
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108940038 (ten1)
DNA replication proteins [BR:sfm03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomere proteins
    CST complex (animals)
     108940038 (ten1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ten1_2
Motif
Other DBs
NCBI-GeneID: 108940038
NCBI-ProteinID: XP_018617343
UniProt: A0A1W5ANZ0
LinkDB All DBs
Position
20
AA seq 141 aa AA seqDB search
MLPEAGIFHFPWEISSGALGDGTAVRTFGRCCARCLSPLFSRLVSYRAEDSLAVLSSQHA
SAQYEVLIHTAFVEPFHPQVGTQYVALGELESKEGIGVVVRARVLNCVEGINLALLQRAV
TEQRRYFEERECETAAQPPPL
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcttccagaagcaggcatttttcacttcccttgggaaatcagttcaggagcacttggg
gatgggacagcggtgaggacgttcggcagatgctgcgctcgctgtctgtccccccttttc
tctagattggtctcttaccgggcggaagattcattggccgtcctttcttcccagcatgca
tcggcccagtatgaggttctgattcacaccgcctttgtggagccgtttcatccgcaagtt
ggaacccagtacgtagctctgggagagcttgagagcaaggaggggattggtgtagttgtg
cgtgctcgtgtgctgaactgtgtagaagggataaaccttgccttactgcagcgtgctgtc
actgaacagagaagatacttcgaggaaagagagtgtgaaactgcagcacagcctcctcca
ctctga

DBGET integrated database retrieval system