KEGG   Scleropages formosus (Asian bonytongue): 108940251
Entry
108940251         CDS       T04919                                 

Gene name
mbd4
Definition
(RefSeq) methyl-CpG-binding domain protein 4
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108940251 (mbd4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sfm03036]
    108940251 (mbd4)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108940251 (mbd4)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     108940251 (mbd4)
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    108940251 (mbd4)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     108940251 (mbd4)
SSDB
Motif
Pfam: MBD HhH-GPD
Other DBs
NCBI-GeneID: 108940251
NCBI-ProteinID: XP_018617767
LinkDB
Position
2
AA seq 470 aa
MKTEEQSGRNPEQQPAKRCPPTTSMPEGWTKVVKQRKTGKTAGKLDVYIKSPQGRTFRSK
AALQVFLQSNEDLGVRVEDFDFTAAGSHAMVSQPERKARRLMCLTDADVTAARTLPTSVK
EEQEAAGIAILPPATSKTTRPKSRAGTRGKAQSNPLLVKQELSDHGLERVGEPSGADSTG
RKEECLSVTPEVREVTILPADIPAKGFQKTVLLRDKLLSKIKLEGSPHTDAQKDQSKLVS
PKGLPASSIGEPASTSHDTDAAIVSPSGLREGLLPASQSLGGSLSPRNQPQSSPRPKAEM
ERKKISPYFSGKSMKEAPSPPRRKAFKKWTPPRSPFCLVQETLFHDPWKLLVATIFLNKT
NGKMAIPVLWQFFERYPTPEVTRESDWLPLAELLRPLGLHELRAKSIIRFSDEYLTKQWR
YPIELHGIGKYGNDSYRIFCVEEWKQVKPKDHKLNKYHAWLWQNHEKLGI
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgaagacagaggaacagtccggccggaaccctgagcagcagcctgcgaagagatgcccc
cccaccaccagcatgccggagggctggacaaaggtggtcaaacagaggaaaacgggaaag
acggcaggaaagctggacgtttacattaaaagtccccagggacgaactttcaggtcaaag
gcggcactccaagtcttccttcaaagcaacgaagatttgggcgttcgggtcgaagacttt
gacttcactgcagcaggaagccacgcaatggtgtcccagcctgagaggaaagcgaggcgt
ctgatgtgtttaacagacgcagatgtgacagctgctcgaactttaccaacctccgtcaag
gaagagcaggaagcagctggcattgccatccttcctccggcgacctccaagaccacgagg
ccaaagtcaagagccggaacaagaggcaaagcacagagcaacccgttgctcgtaaagcag
gagctgtccgaccacggtcttgagagggtgggagagcccagcggagctgacagcacaggc
aggaaagaggagtgtcttagtgtgaccccagaggtcagggaggtcaccatcctgccagca
gatatccctgccaaaggcttccagaagacagtgctcttgagggacaagctgcttagtaag
atcaagttggaaggcagtccacataccgatgctcagaaggatcagtcaaaactggtttct
cccaaaggacttcctgcttcaagtattggagagcctgcaagcacgagtcatgatacagat
gcagccattgtgtctccatcaggactacgagaaggcctgttgccagcctctcagagcctc
ggggggagtttgtcaccaaggaaccagccgcagagcagccctagaccaaaagctgaaatg
gagagaaagaaaataagcccttacttcagcgggaagtccatgaaagaggctcccagcccc
ccaaggcgcaaggcctttaagaagtggacgccacctcgatcacccttctgtctagttcag
gagaccctcttccatgacccctggaagctgctggttgctaccatttttctcaataagacc
aatggtaagatggccatcccagttctttggcagttttttgaacgctaccccacacctgaa
gttacccgtgagagcgactggttgcccctggctgaactgctcagacccctgggcttgcat
gagctgagagccaaaagcatcatcagattttctgacgaatacctgaccaagcagtggcgc
taccctatcgagctccacggcattgggaagtacggcaatgactcgtacagaattttctgt
gtggaggaatggaagcaggtaaagcctaaggatcacaagttaaataagtaccatgcttgg
ctatggcagaatcatgagaaactggggatttaa

DBGET integrated database retrieval system