KEGG   Scleropages formosus (Asian bonytongue): 108940258
Entry
108940258         CDS       T04919                                 

Gene name
ogg1
Definition
(RefSeq) N-glycosylase/DNA lyase
  KO
K03660  N-glycosylase/DNA lyase [EC:3.2.2.- 4.2.99.18]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108940258 (ogg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108940258 (ogg1)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     108940258 (ogg1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     108940258 (ogg1)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     108940258 (ogg1)
SSDB
Motif
Pfam: OGG_N HhH-GPD HHH
Other DBs
NCBI-GeneID: 108940258
NCBI-ProteinID: XP_018617778
LinkDB
Position
2
AA seq 410 aa
MSQHAVLSAGAKAWRSFNCPRSELRLDLTLGCGQTFRWRETSNGHWTGVMGGRVWTLTQT
DDALWYHTYGSQGCPATEDKRKRRGGAEPAQLAKRSKPMVAVKEERDCDQDLGVVNSKWD
GSEEKVLRDYFQLNVPLGELYREWASVDHHFKDIANMFTGVRMLRQDPTECLFSFICTSN
NHISRIQGMIERLCVKLGAPLCQLDGTPYHDFPSIQALADSTVEACLRDLGFGYRARFLQ
QSARQILDSHGPDWLLSLRRAPYLEARDALRTLPGVGLKVADCVCLMSLDKACALPVDTH
MWQIAQRDYRYSVATGRKSLTDKVYQDIGDFFRKLWGSHAGWAHSVLFCADLKKFQKLKE
LPIKKEEGTEVKVELEESTEDVKNGDKGSRQKAKIINPKGLVKKEGSKKS
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgtctcaacatgctgtcctgtctgctggagcaaaggcatggcgttcttttaactgcccg
cggtccgaactgcggctggacttgaccctgggctgtggccaaactttccggtggcgtgag
acgagtaatgggcattggacaggagtgatgggagggcgtgtgtggacattgacacagacg
gatgatgctctgtggtaccacacatatgggtcccagggctgcccagctacggaagataag
agaaaaaggcgaggaggagctgagccagcccagcttgctaagagatcaaagcccatggta
gcagtgaaggaggaaagggactgtgatcaggaccttggggttgtgaactctaagtgggat
ggaagtgaagaaaaagtcttgagggattacttccagttgaatgtgccgctaggggaactg
tacagagagtgggcctctgtggaccatcacttcaaagacatcgctaacatgtttacaggg
gtgaggatgctacgtcaggaccccactgaatgcctcttctcgttcatctgcacctcaaac
aaccacatctcgcgcatccagggcatgatagagcggctatgtgtcaagctgggggccccc
ttgtgccaactggatggcacaccgtaccatgactttcccagtatccaagccctggcagac
agcactgtggaggcctgtctcagggatctgggctttgggtaccgggcccgttttctgcag
cagagtgccaggcagatcttggattcccatggtccagactggctgctgagcctacggcga
gccccctaccttgaggcccgggatgcgctacgcaccttgcctggagtgggtcttaaggtg
gcagactgcgtctgtctaatgtcgctggacaaagcgtgcgcgttgcccgtggacacgcac
atgtggcagatcgcacagagggactaccgctactctgtggcaacgggacgcaagagcctg
accgacaaggtttaccaggacatcggtgactttttcagaaagctgtggggatctcatgct
ggctgggcacactctgttctgttctgtgccgatttgaagaagttccagaagttgaaagag
ctgccaattaaaaaggaggaaggaacagaggttaaagtggagcttgaggaaagtactgag
gatgtgaaaaatggagacaaaggtagcaggcagaaggcaaagattataaatcccaagggt
ttagtgaagaaggagggcagtaagaagtcttga

DBGET integrated database retrieval system