KEGG   Scleropages formosus (Asian bonytongue): 108940297Help
Entry
108940297         CDS       T04919                                 

Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00512  Mucin type O-glycan biosynthesis
sfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    108940297
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sfm01003]
    108940297
Enzymes [BR:sfm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     108940297
Glycosyltransferases [BR:sfm01003]
 O-Glycan biosynthesis
  Mucin-type
   108940297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 108940297
NCBI-ProteinID: XP_018617857
UniProt: A0A1W5AQF2
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSEELVQVGRGSESRIRGRNGKVGTLAD
RQSILQRLEHLEDVVYNQLNGLAKPMGLVEGPGGLGQGGAAATLRDDSHETEGKYEQYGY
NGQLSDRISLDRTIPDYRPKKCKQITYPDDLPQISVVFIFVNEALSVILRSVHSVVNHTP
AHILKEIILVDDNSDSVELKFNLDQYVNKRYPGLVKIVRNSKREGLIRARIQGWRAATSP
VVGFFDAHVEFNTDWAEPILTRIKEDHTRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQEWLDKGDETAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCARVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEYKSHVYMAWNIP
MSNPGVDFGDVSERIALRKKLNCHSFQWYLEHVYPEMRVYNNTITYGEVRNSKASGYCLD
QGSEDDDKAILYPCHGMSSQLARYSTEGLLQLGPLGSTSFLPDTKCLIDDGRGRTPSLKK
CDAVSRISQRLWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HPRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggcacgcaaaatcaaaactttgctgactgtcaacatcttggtgttcgtgggg
attatactgttctcggtgtactgcagaattcaggatcgctccgaagaactggtgcaggtg
ggcaggggctcagagtcgaggatccgcggccggaatggtaaagttggcaccttggcggat
agacagtccatacttcagaggctggagcatctggaggatgtggtctacaatcagttaaac
ggtcttgctaagcccatgggccttgtggaaggtccaggagggctgggtcagggtggtgcc
gctgccaccctgagagacgacagccatgagacggaagggaagtacgagcaatatggctac
aatggacagctgagtgatcgcatctcattggacagaaccatccctgactacaggccaaaa
aagtgcaagcaaataacatatccagatgacctccctcagatttccgtagtcttcatcttt
gtgaatgaggccttgtctgttatcttgcggtctgttcatagtgtggttaaccacactcca
gcacatattctcaaggagatcattctggtggatgacaacagtgatagtgtggagctgaag
ttcaacctggaccagtatgtcaacaagcggtaccctggcttagtgaagatagtgcgcaac
agcaagagggaaggcctcatccgtgctaggatacaggggtggagagcagcaacatcccct
gttgttggcttctttgatgcccatgtggagttcaacactgactgggcagaaccaatactg
accagaattaaagaggatcacactcgcatcatcctccctgcaatagataacatcaagtac
aacacatttgaggtgcaacagtacgccaatgcagcccatggctataactggggcctctgg
tgcatgtacatcatcccaccgcaggagtggctggacaagggagatgaaacagcacccatt
cgaacaccagcaatgattggctgttccttcgtggtggacagagaatactttggagagatt
ggacttctggatcctggcatggaggtctatggaggggaaaacattgaacttggaatgagg
gtatggcaatgtggtgggagcatggaggtgctgccttgtgctcgggtggcccacattgag
cgcaccaagaagccctacaacaacgacattgattactacgccaaacgcaatgccctgcgt
gcagctgaggtctggatggatgagtacaaatctcatgtctacatggcgtggaacatccca
atgagtaatccaggagtggacttcggagatgtttccgaaaggattgccctcagaaagaaa
ctgaactgccacagtttccagtggtacctggagcatgtgtaccctgaaatgagagtttac
aacaatactatcacctatggtgaggtgcggaacagcaaggctagtggctattgtttggac
caaggatcagaagatgatgacaaagccatcctgtacccttgccatggcatgtcttctcag
cttgcccgttactcaacagaaggtctcctgcaattaggaccactaggttcaacttcattt
ctgcctgacacaaaatgtctcatagatgatggcagaggacgtactccaagcttgaagaag
tgtgatgctgtttctcgaatatctcaaaggctctgggatttcacacagaatgggccaatt
atcagcagagacactgggcggtgcctagaagtggaaatgtcaaaagatgccaattttggc
cttcggctggtggtgcagcggtgctctgggcagaagtggatgatacggaactggattaaa
cacccgagacattag

DBGET integrated database retrieval system