KEGG   Scleropages formosus (Asian bonytongue): 108940338Help
Entry
108940338         CDS       T04919                                 

Gene name
gck
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00010  Glycolysis / Gluconeogenesis
sfm00052  Galactose metabolism
sfm00500  Starch and sucrose metabolism
sfm00520  Amino sugar and nucleotide sugar metabolism
sfm00524  Neomycin, kanamycin and gentamicin biosynthesis
sfm01100  Metabolic pathways
sfm01200  Carbon metabolism
sfm04910  Insulin signaling pathway
Module
sfm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sfm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108940338 (gck)
   00052 Galactose metabolism
    108940338 (gck)
   00500 Starch and sucrose metabolism
    108940338 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    108940338 (gck)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108940338 (gck)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108940338 (gck)
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     108940338 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 108940338
NCBI-ProteinID: XP_018617940
UniProt: A0A1W5AXJ4
LinkDB All DBs
Position
Unknown
AA seq 461 aa AA seqDB search
MPGDHCTMEKVDHILSEFRLDEDDLMEVMRRLQKEMERGLRLETHEEASVKMLPTYVRST
PEGSEVGDFLALDLGGTNFRVMLVKVGEDEERGWKVETKNGMYSIPEDAMTGTAEMLFDH
VAECISDFLGKHHIKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKVSGAEGNNVVGLL
RDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRRCEVGMIVGTGCNVCYMEEMRTVELVE
GEEGRMCVNTEWGAFGDHGELEEFRLEYDRVVDETSVNSGQQLYEKLISGKYMGELVRLV
LLKLVSENLLFNGEASEQLRTKGSFDTRYVSQIESDSGDRKHIYNILTTLGLLPSERDCD
IVRLACESVSTRAAHMCAAGLAGVINRMRERRSQEDLKITVGVDGSVYKLHPCFQDKFHR
VVRDLTPHCDITFLQSEEGSGRGAALVSAVACKMATCMLTQ
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcgaccactgcaccatggagaaggtggaccacatcctttcggagttcagactg
gacgaggacgacctaatggaggtgatgaggaggttgcagaaggagatggagcgtgggctg
cgtctagagacacacgaggaggccagcgtcaaaatgttacccacttacgtgcgctccacc
ccagagggctctgaggtgggtgattttttggccctggacttaggaggaacaaacttccgc
gtgatgctggtgaaagtgggagaggatgaggagaggggctggaaggtcgagaccaagaac
gggatgtactccatcccggaggatgccatgacaggcacggccgagatgctgttcgaccat
gttgctgagtgcatctccgacttcctgggcaaacaccacattaaacacaagaagctgccc
ctgggcttcaccttctccttccctgtgcgacatgaggacatagacaagggaatcctactg
aactggaccaagggcttcaaggtctctggggctgagggcaacaatgtggtgggcttactc
cgagacgccatcaagagaagaggggactttgaaatggatgtggtcgcaatggtgaatgac
acagtggccaccatgatctcctgctactacgaagaccgcagatgtgaggttggcatgatt
gtagggaccggctgcaacgtgtgttacatggaggagatgcgcacggtggagctggtggag
ggtgaagagggtcgcatgtgcgtcaacacagagtggggggcctttggagaccatggtgag
ctggaagaatttcgtctggagtacgaccgcgtggtggacgagacatctgtcaattctggc
cagcagctttacgagaagctgatcagcgggaagtacatgggcgagctggtgcggctggtg
ctgctgaagctggtcagcgagaacctgctgttcaacggcgaggcgtccgagcagctgagg
accaagggcagctttgacacccgctatgtgtcccagatagaaagtgactctggggacagg
aagcatatctacaacatcctgacaacgctggggctgctgccctcagagcgagactgcgac
attgtgcgtctggcatgcgagagtgtgtctacgcgtgcggcccacatgtgcgcggcgggg
ctggctggtgtcatcaaccgcatgagggagcgtcgcagccaggaggatctcaagatcacc
gtgggcgtcgacggctccgtctacaagctgcacccctgttttcaggataagttccacaga
gtagtgagggatctgactcctcactgtgacatcaccttcctgcagtctgaggaagggagc
ggtcgaggcgcagccctggtttcagcagtggcctgcaagatggcaacgtgcatgctgacc
cagtga

DBGET integrated database retrieval system