KEGG   Scleropages formosus (Asian bonytongue): 108940341Help
Entry
108940341         CDS       T04919                                 

Gene name
alk
Definition
(RefSeq) ALK tyrosine kinase receptor
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108940341 (alk)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:sfm04090]
    108940341 (alk)
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108940341 (alk)
Protein kinases [BR:sfm01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   108940341 (alk)
CD molecules [BR:sfm04090]
 Proteins
  108940341 (alk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase MAM Gly_rich Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 108940341
NCBI-ProteinID: XP_029114410
UniProt: A0A1W5AXN8
LinkDB All DBs
Position
15
AA seq 1679 aa AA seqDB search
MTLSARCLFVLSAALLLELQCAAQRDAIGVALSGTATSASSASLDSKKDSNQTSTSRRKR
KNLSVDFAVPSLLRNYLSEFTKRPLHGDCAAFGGGCAHTVRSSLSMQCVPLQRTVSSLLE
TRLSPVDGPQRGNGSAGAQLPSRTRRPLSKVLNLALTKDSRKSNQVVVEIGEQNVRTGCG
GLSADGDVLEVDLTPILEWWLGAGGGRLRVRLIPERRAQVPGREEKYSAAIRAADPRFFL
QIVSRGTVQSGRGAGVPRGYWNFTWMAEDELSFPVETTPAESRCHGNGGQPCSWPPPLGP
DTQFAVLPAGSLQNSERCTRYSRRWDEGQFLSVNSSTMGGPWVSSPWLRGGHWRCSLDVS
IFLHPQQSGRYMVWLIERDKKPRVLLITNAPRSTGWAALRLTLGNQPDPFRIWSSYSEPS
DRDAGAFEPTFATNCTLDSSPAPNITLQGRYGCRQGPDIALGQMCDFQPDCPLGDDEGDA
CSGFINGSYCSFEKGDCGWRSVSGRGPSWKVLESKPGVSAPVCQSRGAVMAVGGSHSKGP
QGVPLLRSPMFPPPLRNAVCEVRFWLCSGGRHSGALSLWVVENSTEPGEKRSLWRSANGM
QPRPGWRLVTLPLYGLADWFWLQFSTEELPAPGSVLAIDNFSLSTDCFLASNGEFPPVIN
TINVMGPEATTQDWRPTPTALYPPTLTPAPGEVKWTFHTCGATGPEGPTPIQCTNSYSNT
NINVTVGTRGVLKGIQMWRVPETGTYRITGYGAAGGRSVMAPTRSHGIYISGDFHLQRHE
VLYILVGQQGEDACPNSNKTLNKVCLEQTLLIDNRTQAKWAGGGGGGGGATYIFKMLKGV
PVPLLIAAGGGGRGYSSKSERQEEIMDRDPSVPGRNGRSGAAGGGGGWNDSAPVAQGGRP
LILGGQGGAACAFGWHTRGGFGGGGGACSSGGGGGGYRGGSTSQENNPKQDGKDGSSFIS
PEGVIFIEPLKVIETHGEVEILPVLNCSHCESGDCHKSDGKIVCYCEEDLAPDGVSCINK
TDAAIVPPQLHLSQLALGLSVGTSALIAALLLAVSGVMIMYRRKHTELQSIQLELQSPDC
KLSKLRASTIMTDYNPNYCFAGKTASVSDLKEVPRRNISLIRGLGHGAFGEVYEGLAVGI
PGEPSPMQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLEL
MAGGDLKTFLRENRPRVDQPSSLSMVDLLNVARDIARGCQYLEENQFIHRDIAARNCLLT
CKGPGRVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFMEGIFTSKTDTWSFGVL
LWEIFSLGYMPYPSRSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQSWQHQPEDRPNFST
ILERIDYCLQDPDVVTTPLPVEYGPVQEEEERVPMRPEDPAATSLLCVPGREDGPSTVEG
AREQPVQASQPPAGLPPEAVPAAAAPPPSQLHLQATQQPTPAAAPTPTPTPTPTSAQPGA
EGGHVNLGFTQGQPLEKEGRNGKPTNLLNPTYGSWFLQQQQRPSLQLQHKQMLHQQQQQQ
QALCRPLLPPPPPPGAPTAPLLLDSAALPSIPLFRLRRFPCGTIGYGYQEQGLPRESHAA
QPPPPPPPPPPPPPAPQRPVSLARAGIPEDSRPLLVTMGTATLQDPRLPKLEGHNATVL
NT seq 5040 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcagcgcgcggtgcttgttcgtcttatccgcggcgcttctgctcgagctgcag
tgcgcggcgcagagggacgcgatcggggtggctctgtctggcactgccacgagcgccagc
agcgcgagcctggactccaagaaggactccaaccagaccagcacgtcccggcgcaagagg
aagaacctgtcggtggacttcgccgtcccctccctgctgaggaactacctgtccgaattc
accaagcggcccctgcacggggactgcgcggctttcggcggcgggtgcgcgcacaccgtg
cgctccagcctgagcatgcagtgcgtccccttgcagaggaccgtgtccagcttgctggag
acccggctgagcccagtcgacggcccccagcgcggaaacggctcggcgggcgcgcagctc
ccgtcccggacgcggcgaccgctctccaaggtgctgaacctggccctcaccaaggacagc
cggaagtccaaccaggtggtggtggagattggggagcagaacgtgcggaccggctgcggg
gggctctcggccgacggggacgttctggaggtggacctcactcctattctggaatggtgg
ttgggagccggaggggggcggctcagggttcggctcatccccgagcggcgggcgcaggtt
cccggacgggaggagaagtactcggccgccatccgagctgcggacccgcgcttcttcctc
cagatcgtctcccgtggtacggtccagtctggacgtggcgctggggtacctagaggctac
tggaacttcacctggatggcagaagacgagctgagcttcccggtggagaccacgccagca
gagtcccggtgccatggaaacggtgggcagccgtgcagctggcctccaccgctaggtcct
gacactcaatttgctgtgctgccagctggtagcctacaaaatagcgagagatgcacacgc
tacagtaggaggtgggatgagggccagttcctgtctgtgaacagctccacaatggggggc
ccctgggtgtccagcccctggctccgtgggggacactggcgctgcagcctggacgtgtcc
atcttcctgcacccccagcagagtgggcgctatatggtgtggctcatcgagagggacaag
aaacccagagttcttctcatcaccaatgcaccacgcagcacaggctgggcggctctgcgg
ctcaccctgggcaaccagccggacccgttcaggatctggtcgagctacagcgagccgagc
gacagggacgcgggcgccttcgaacccaccttcgccaccaactgcaccctggattcgtcc
ccggcaccaaacatcaccctccaggggcgctacggctgccgccaggggcccgacatcgcc
ctgggacagatgtgcgacttccagcctgactgccctctcggggacgacgagggagatgcg
tgcagtggcttcatcaacggcagctactgctcctttgagaagggcgactgcggctggcgc
tctgtgtctggccgggggccgtcctggaaggttctagaatcaaagcctggggtcagcgct
cctgtgtgccagtctcgaggagcagtcatggctgtgggtggaagtcattccaaaggaccc
cagggagtgccattgttgcgcagtccaatgttccccccacctctcagaaatgccgtctgt
gaggtgcgcttctggctgtgttctggaggacgccacagcggggcgctgtccctctgggtg
gtggagaacagcacggagcctggagagaagcgcagtctgtggcgctcggccaacggcatg
cagccacggccgggttggcgactcgtcaccctccctctgtacggcttggcggattggttc
tggctgcagttcagcacggaggaactcccggctcctgggtcggtgttggccattgacaac
ttctccctcagcacggactgcttcctggcctccaacggggagtttccaccggttatcaac
acgataaatgtcatggggcccgaagcaaccacccaggactggagacccaccccgacagcc
ctgtaccccccaaccctgacccctgctcccggagaagtcaagtggactttccacacatgt
ggtgccacaggtccagagggacccactcccattcagtgcaccaactcatacagcaacacc
aacatcaacgttaccgtgggaaccaggggagtactcaagggaatacagatgtggcgagtc
ccggagacagggacctacaggattactggctacggtgcggcaggcggtcgcagcgtgatg
gcccccacccgctcgcatggaatctacatcagcggggacttccacctgcaacgccatgag
gtcctctacatcctcgtgggacagcaaggagaggatgcctgtccaaactcgaacaaaacc
ctcaacaaggtgtgtctggagcaaactttgctgattgacaacagaactcaagctaagtgg
gcaggaggaggtggcggagggggcggagccacctacattttcaagatgctgaagggagtg
ccggttcccctgctcattgcggccggtggaggagggcgtggctacagcagcaaatcagag
aggcaagaggagataatggacagagaccccagtgtccccgggcgcaatgggcggtcagga
gctgcaggtggaggtgggggatggaacgacagcgcacccgtggcccagggaggcaggccg
ctcatcctgggggggcaggggggtgcggcctgtgcgttcggctggcacacgagagggggt
ttcggcggcgggggcggagcctgttcctccggcggtggaggaggcgggtaccgcggcgga
agcacatcgcaggagaacaacccgaagcaggatggcaaggacggctcctccttcatcagt
ccagagggtgtcatcttcatcgaacctctgaaagtgattgagacccacggggaggtggag
atcttgcccgtgctcaactgcagccactgtgagtcgggcgactgccataagagcgacggc
aagatcgtgtgttactgcgaagaggatctcgcccctgacggggtgtcctgcatcaacaaa
acagatgccgcgattgtgccgccccagctgcacctctcccagctggctctgggcctgtcc
gtggggacgtccgccctcatcgctgccctgctgctggccgtgtccggagtcatgatcatg
tacagacgcaagcacaccgagctccagtccatccagctggagctgcagagccccgactgc
aagctgagcaaactgagggcctccaccatcatgaccgactacaaccccaactactgcttt
gctggcaagaccgcgtccgtcagtgacctcaaggaggtcccccggcggaacatctccctc
atcaggggtttgggtcatggtgcattcggagaggtgtacgaaggcttggctgtgggaata
cctggggaaccaagccccatgcaggtggcagttaagactcttccagaagtctgctctgag
caggatgagctggacttcctcatggaggctctgattatcagcaagttcaaccaccaaaac
atcgtccgttgcatcggcgtgagcctacaggcgctgccccgcttcatcctgctggagctc
atggctggtggggacctgaaaaccttcttgcgagagaaccgaccccgagtggaccagccc
tccagtctctccatggtggacctgctgaacgtggcccgggacattgcacggggctgccag
tacctcgaggagaatcagttcatccacagggacatagctgcccggaactgcctgttgacc
tgcaaaggacctgggagggtggccaagatcggagacttcgggatggccagagacatatac
agggcaagctactacaggaaaggaggtcgagctatgctgccagtcaagtggatgccccca
gaagccttcatggagggtatcttcacctccaagactgatacctggtccttcggagtgttg
ctttgggagatcttctctctgggctacatgccttaccccagccgcagcaaccaggaggtg
ttggagttcgtcaccagcggaggcaggatggatcctcccaagaactgcccagggccggtg
tatagaataatgacacagagctggcagcatcaaccggaagacagacccaacttctcaacc
atactggagcggattgactactgcttacaggatcccgacgtggtgacgacgccccttcca
gtggagtatggtccggtgcaggaagaggaggagcgggtgcccatgagaccggaggacccg
gccgccacgtcgctcctgtgtgttccgggccgggaggacggcccctcgacggtagagggc
gccagagagcaacccgtccaggcctctcagccgcccgctgggctccctcccgaggctgtg
cctgccgcggccgcaccgccgccttcgcagctccacctccaggccacgcagcagccgacc
cctgccgctgccccgacccccacccccacccccacccccacttccgctcagcccggagca
gagggggggcacgtcaacctgggattcacacagggccagcccctggaaaaagagggccgc
aacgggaagcccaccaacctgctgaaccccacttacggctcctggttcctccagcagcag
cagaggcccagcctgcagctccagcacaagcagatgctccaccagcagcagcaacagcag
caggcgctgtgccgccccctgctgccccctccccccccgcctggggcgccgaccgccccg
ctcctcctcgattcggccgcccttccttccatccccctgttcagactgcgccgtttcccc
tgcgggaccattggctacgggtaccaggagcagggcctgccccgggagtcgcacgcggcc
cagccgcccccaccgcccccgccccctcccccaccgccgcccgcgccccaaaggcccgtt
tcgcttgcccgtgcgggcatccccgaggacagtcgcccgctgctcgtcaccatgggaacg
gccacgttgcaggacccgaggctgccgaaactcgaggggcacaacgccactgtgctttaa

DBGET integrated database retrieval system