KEGG   Scleropages formosus (Asian bonytongue): 108940463
Entry
108940463         CDS       T04919                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04068  FoxO signaling pathway
sfm04110  Cell cycle
sfm04115  p53 signaling pathway
sfm04218  Cellular senescence
sfm04310  Wnt signaling pathway
sfm04340  Hedgehog signaling pathway
sfm04371  Apelin signaling pathway
sfm04510  Focal adhesion
sfm04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108940463
   04340 Hedgehog signaling pathway
    108940463
   04371 Apelin signaling pathway
    108940463
   04068 FoxO signaling pathway
    108940463
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108940463
   04115 p53 signaling pathway
    108940463
   04218 Cellular senescence
    108940463
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108940463
   04530 Tight junction
    108940463
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 108940463
NCBI-ProteinID: XP_018618190
LinkDB
Position
2
AA seq 401 aa
MGRTKNLSLFKTCPSLCGPLSLARSRSLCRSPTRAVRAFDLPLTTSRVTAHGAKGTSCRG
RKATRSRASGRLRFRAASAEAPVTQTAARAQSRAPAGSPREARRETPADMEQLLCCEVET
IRRAHQDANLLNDRVLHTMLKVEENYLPSANYFKCVQKDVVPYMRRIVATWMLEVCEEQK
CEEEVFPLAMNYLDRFLSVEPIKKSRLQLLGATCMFLASKIKETIPLTAEKLCIYTDNSI
RPSELLQMELLALNKLKWDLASVTAHDFIEHFLSKLPVHQDTKQILRKHAQTFVALCATD
VKFIASPPSMIAAGSVAAAIQGLHLKSTDSLLSSQSLTDFLSQVIKSDPDCLRACQEQIE
SLLETSLRQAQLTHNGSTDPKGIGEEADLSCTPTDVRDVNI
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgggacggaccaagaacttgtcgctctttaagacttgcccttccctgtgtggccctctc
tctctcgcgcgctcccgctcgctctgtcgctcacccacccgcgcagtccgtgcctttgat
cttcccttaacaacaagtcgcgtcaccgcacacggcgctaaaggcacttcgtgtcgggga
aggaaggcgacgcgcagcagagcctccggaaggcttcgcttcagagcagcatccgcggaa
gctcctgtcacgcagaccgccgcccgcgcccagagccgcgcacccgcaggcagccctcga
gaggcccggcgagagaccccagcagacatggaacagctgctgtgctgcgaagtggagacg
atccggagagcgcaccaggacgcgaacctgctcaacgaccgggtcctgcacactatgctc
aaagtggaggagaattacctgccttccgcgaattacttcaagtgcgtgcagaaggacgtg
gtgccgtacatgaggaggattgttgccacgtggatgctggaggtctgcgaggagcaaaaa
tgtgaagaggaggtttttcctttggctatgaactatttggacagatttttgtcagtggag
cccataaagaaatccagattacagttactgggagctacgtgcatgtttctggcttctaag
atcaaggaaaccatccctctgactgcggagaagttgtgcatttacaccgacaactccatc
agacccagtgaactcttgcagatggaactcctggcgttgaataaactgaaatgggatctg
gcctcggtgactgcccacgattttattgagcacttcctctccaaactgccggtccaccag
gacaccaagcagatcctgcgcaagcatgcccaaacttttgtggccctgtgtgcaacagat
gtgaaattcatcgccagcccaccctccatgatcgcggctggcagtgtggcggcagccatc
cagggcctgcacctcaagagcactgacagcctactttcgtcacagagcctcacagacttc
ctgtcacaagtgatcaagagtgacccggactgcctgagagcatgtcaggagcagattgag
tcattgctggagacaagcctgcgacaggcacagctgacccacaatggctctacggacccc
aagggcatcggtgaggaggcggacctttcctgcacacccacagatgtgcgggacgtaaac
atctga

DBGET integrated database retrieval system