KEGG   Scleropages formosus (Asian bonytongue): 108940785Help
Entry
108940785         CDS       T04919                                 

Gene name
mapk6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108940785 (mapk6)
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108940785 (mapk6)
Protein kinases [BR:sfm01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108940785 (mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 108940785
NCBI-ProteinID: XP_018618660
UniProt: A0A0P7V7K4
LinkDB All DBs
Position
Unknown
AA seq 723 aa AA seqDB search
MAEKFESLMNIHGFDLGPRYMDLKPLGYGGNGLVFSAVDKDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPNGRQLTEDVSSLTEVNSVYIVQEYMETDLCQLLE
QGMLSEGHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILQSIPVIHEEDRQELQSVVPVFVRKDMSKPQTPLAKLLPGVSEEALDFLREILTFN
PMDRLTAEEALAHPYMSDYSFPLDEPISSHPFHIEDEVDDILLMDESYSHVYNNWDRYHD
SQYSDQDWNLYSTHEADNVQLDPRAISEGTDEEVVQVDPRKYLDGDREKLLEDPVFGSFF
PSELSWQLEDHHENKYCELECSHTCNYKTVSPLYLDNLVWGDSEVNHYYEPKLIIDLSNW
KEQSKEKADKKGKSKCEKNGLVKAQIALEEASQNTSEKDKEQEKNQGFDFDSFIASTIKL
SLQPEHSEVGFLNELNSSVSQLEIKSSVPKSISQEKEEKCIVNLAQLEGRAPNPWECFSP
LGVSSEESGLIDEVCWDVRKDEQVQKETTYTSYLDKLFSKREEILEVMDPEPVVEIKEMD
EGFLTRNGELMFNMQFESLALPQFDTSADSPLKSIQATLAPPAVKCSPKIAHKTYSSILK
HLN
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaagtttgaaagtttgatgaacattcacggctttgatctggggccccgttac
atggacctcaaacctttgggctatggcggcaatggtctggtcttctctgctgtggacaaa
gactgcgacaagagggttgctgtcaagaagattgtcctcacggacccgcagagcgtgaag
cacgccttaagggagatcaaaataattaggcgcctggaccatgacaacatcgtgaaggtg
ttcgagaccctcgggcccaatggcaggcagttgacagaggacgtgagctcactgacggag
gtcaactctgtctacatcgtgcaggagtacatggagacagacctatgccagctgctggag
caggggatgttgtccgaaggccatgcccgcctctttatgtaccagctgctgaggggcctc
aagtatatccactccgccaatgtcctacaccgggacctcaaacccgccaacctcttcgtc
aacacagaggacctggtgctgaagatcggagactttgggcttgcacgcattatggacccc
cactattcacacaaggggcatctttccgaaggactggtcacaaagtggtacagatctccc
cgccttctgttgtcacccaataattataccaaagccattgacatgtgggcagctggctgc
atttttgctgagatgctgacgggaaaaactctttttgcaggtgcccatgagctggagcag
atgcagctgatcctgcagtccatacccgtgatccacgaggaggaccggcaggagctacag
agtgtcgttccagtctttgttaggaaggacatgtcaaagccacagaccccattggccaag
cttctccctggggtcagcgaagaggctcttgatttcctgagggaaatcctgacattcaac
cctatggaccgcctgactgctgaagaggcattagcccacccatacatgagtgactactct
ttccctctggatgagcccatttccagtcaccccttccatattgaagatgaagttgatgac
atcctgctgatggatgagagctacagtcatgtgtacaacaactgggacagatatcacgac
agccagtattcagaccaagactggaatctttatagtacccatgaagcagataatgttcag
ctagatccccgagctatatcagagggtactgatgaagaggtggttcaggtagaccctcga
aagtacctggatggagaccgggagaagttgctggaggatccagtttttggctcctttttt
ccctctgaactctcctggcaacttgaagaccaccatgagaacaagtattgtgaactggaa
tgtagtcatacgtgcaactataaaaccgtctcccccttatacctggacaacctggtctgg
ggagacagtgaggtcaaccactattatgagcccaagctcatcatcgacctgtccaactgg
aaagaacagagcaaggagaaggcagacaaaaaaggcaagtccaagtgtgagaagaatggc
ctggtcaaggcccagattgcactggaagaagcctcccagaatacatctgaaaaagacaag
gagcaggagaaaaaccagggctttgattttgactccttcattgccagcaccatcaagctt
agcctccagccagagcacagtgaggttggcttcctcaacgaactgaacagttcggtctcc
cagctagagatcaagagctccgttccaaagtctatcagtcaggagaaggaggagaagtgc
atagtgaacttggcccagctagaaggtagggcacccaacccctgggagtgcttcagcccc
ctgggtgtctctagtgaagaaagtggcctgattgacgaggtatgctgggatgtgaggaaa
gatgagcaagtgcaaaaggaaactacctacaccagctatttggacaagctcttcagtaag
agggaggagatactggaagtgatggacccagagccagtagtggagataaaggagatggat
gagggcttcctgaccagaaatggagagctcatgtttaacatgcagtttgagtccctggcc
ctccctcaatttgacacctctgccgattcaccccttaagtccatacaggccacattggca
cccccagctgtaaaatgttctcctaaaattgcccacaaaacatacagcagcattttaaaa
catttgaattaa

DBGET integrated database retrieval system