KEGG   Scleropages formosus (Asian bonytongue): 108941448Help
Entry
108941448         CDS       T04919                                 

Gene name
msh4
Definition
(RefSeq) mutS protein homolog 4
  KO
K08740  DNA mismatch repair protein MSH4
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108941448 (msh4)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutS homologs specialized for meiosis
     108941448 (msh4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MutS_V MutS_III MutS_IV MutS_II AAA_14 ATPase_2 AAA_23 AAA_30 AAA_29
Motif
Other DBs
NCBI-GeneID: 108941448
NCBI-ProteinID: XP_029114187
UniProt: A0A1W5AVU3
LinkDB All DBs
Position
15
AA seq 928 aa AA seqDB search
MEMIRSSTEEVSAGGSPVSSVAVRERPRLSTTPGPSTSGRGTVASSSRTSTGSSPEASCA
CASPSGGGEGSGALNSKDSYQADLSANTGQISLSAIISAHSSSSHRCLSTPRVWQALCTT
GRHPTRTPQVDHTVTTCSSTTSGVCSVMVAVVEGRGLARGEIGMASINLKFPELVLSQFA
DTGTYAKVITRLHILNPLEILMPDTVREKGKGAKLFSLITENFQAVAFTAIQRKYFNEKK
GLEYIQNLCAPEFSTVFMEVQTKYYCLAAASALLKYTEFVQNCIYAPKSLKVSFKGSEQT
AMIDSTSAHNLELVVNNRDHKSEHTLLGVLNYTRTPGGARRLRSNILEPLLDIDTINTRL
DAVHELLQDEELFFGMKNAIGHFLDIDQLLSVLVQIPKQETVQVAEAKIVHVIQLKHTLE
LVIPLKAALRSCQTALLKAYYSSLEDSRFDRILEQIKTVINNDTSYMKGSLNMRTQKCYA
VRPNINEFLDIARRAYTEIVDDIAGLVTNLAEKHNLPLRTSFSSVRGFFIQVKLESVALP
HGQLPVEFIKVTKHKNNYSFTTADLIKMNDHCEEALREIFHMSYVVVCQLLSTVHEHINC
LYKLSDSVSMLDMLLSLANACTVSDYVRPEFTDTLAIKQGRHPILERIYGQQPVSNNSYI
SESNNFVIITGPNMSGKSTYLKQVALCQIMAQIGSFVPAQYASFRIADQIFTRIGVDDDF
ETNSSTFMMEMKEVSYIIHNISDRSLIIMDELGRGTSAEEGIGICHSVCEFLLNFKAFTL
FATHFLELCQLETLYLNVENQHMEVRHTRAASSGAESIVYTYLLSQGISEERNYGLRAAE
MTALPQSVIQEAKQIASRVSQQLKAKQHSDPKTLRNRAVYRLATRLLQAARNSRLDSASL
RLYLQDLRRQYEAELQVAEEPASIDMEG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgatccgtagcagcaccgaggaggtgagcgccggcggcagccccgtgtcctcg
gtggccgtccgagagcggccacggctgagcacgacccccggaccctccacgtcaggacgc
ggcactgtggcgtcgagctccagaacgagcacaggcagcagccccgaggcctcatgcgct
tgcgcgtccccttcaggaggaggggaagggagtggagcgctgaactctaaagactcttac
caagcagacctcagcgccaacacgggtcaaatcagcttgtctgccatcatttcggctcac
agcagctcctcccaccgctgtctgagtacgccaagagtgtggcaggccctgtgcaccaca
ggcagacaccccacgcggactccgcaggtggaccacacagtgaccacctgctcctctact
acctctggtgtttgttccgtgatggtggccgtggtcgaggggcggggcctggcacggggt
gagattggcatggccagcattaatctgaagtttccggagctcgtgctctctcagttcgct
gacactgggacttatgccaaggttatcaccaggctgcacattctaaaccccttggaaata
ttgatgccagacacagtcagggagaagggaaagggggctaaactctttagtctcatcact
gagaacttccaggctgtggccttcactgccatccagaggaagtatttcaatgaaaaaaaa
ggcctggagtatattcaaaatttgtgtgcaccagagtttagcactgtctttatggaagtc
cagactaaatactattgcctggccgcagcctctgctctgctgaaatacactgagtttgtc
cagaactgcatctacgcacccaagtcacttaaagtgagcttcaaaggcagcgagcaaaca
gccatgattgactccacctctgcgcacaacttggagctggtggtcaacaacagggaccac
aaaagtgagcataccttgctcggggtgctgaactacacgagaacccctgggggggcacgg
cgcctgcgctccaacattctagagcccctgctggacatcgacaccatcaacacccgactg
gacgctgtgcacgagctgctgcaggatgaggagctcttctttggcatgaagaatgccatt
ggacactttctggacatagaccagctgctctctgttctagtgcagatccccaaacaggaa
acggttcaagtggctgaagcaaagatagtgcatgtgattcagctgaaacacactttggaa
cttgttataccactgaaggcagccctgcggagctgtcagactgccctgctgaaggcctat
tacagctctttggaagatagcaggttcgacagaatcctggagcagatcaagacggtgata
aacaatgacaccagctatatgaaaggcagcctaaacatgcgcactcagaagtgctacgcg
gtgcggcccaacattaatgagttcctggacattgcacgccgtgcctacactgagattgta
gatgacattgcaggactggtgacaaatcttgcagagaagcataacctgccacttcggacc
agctttagttcagtgcgtggcttcttcattcaagtgaagctggaaagtgtagccctgcct
catggacagctcccagtagagttcattaaggtcactaagcacaagaacaactacagcttc
accacagcagatctcatcaagatgaatgaccactgtgaagaggcactgagggaaatcttc
catatgtcatatgtggttgtatgccaactgctgagcacagttcatgagcacataaactgc
ctctacaagctgtctgactctgtctccatgctggacatgctgctgtcgctggccaacgct
tgcaccgtctctgactacgtgcggccggagttcactgacacactggccatcaagcagggc
cgacaccctattctggagcgcatctacggacagcagcccgtctccaataacagctacatc
tccgagagcaacaactttgtcatcatcactgggcccaacatgagtggcaagtccacctat
ctcaagcaggtggcactgtgccaaatcatggctcagataggctcctttgttccagctcag
tatgcatctttccgaatcgctgaccagatttttactaggataggggtagatgatgacttt
gagacaaactcctctaccttcatgatggaaatgaaggaggtgtcgtacataatccacaac
attagtgacagatctctcattatcatggatgaactgggaaggggcaccagtgctgaggaa
ggcattggtatctgtcactccgtttgtgagttcctcctcaacttcaaggcattcaccctt
tttgccacccactttctggagctgtgccagctggagacactttacctaaacgtggagaac
cagcacatggaggtgcgccacacccgggcagctagctcaggagccgagagcattgtctac
acttacctcctgagccagggcatctcagaggagaggaactatggtctgagggcagcagaa
atgacagcgctgccacagtctgtcatccaggaagcaaagcagattgcgagcagagtcagc
cagcagttgaaggccaagcagcacagtgaccccaagacgcttcgtaaccgggcggtttac
cgcctggccacccgcctcctgcaagctgccagaaactcacggctagattcggccagcctc
cgcctctacctgcaggacctcaggaggcagtatgaggcagagttgcaggttgctgaggag
ccagcgtccatagacatggagggatga

DBGET integrated database retrieval system