KEGG   Scleropages formosus (Asian bonytongue): 108941494Help
Entry
108941494         CDS       T04919                                 

Gene name
gstz1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00350  Tyrosine metabolism
sfm01100  Metabolic pathways
Module
sfm_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    108941494 (gstz1)
Enzymes [BR:sfm01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     108941494 (gstz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 108941494
NCBI-ProteinID: XP_018619718
UniProt: A0A1W5B1A5
LinkDB All DBs
Position
Unknown
AA seq 221 aa AA seqDB search
MHVSLRCLVKPVLLHGYFRSSCSWRVRIAFALKGIDYDQVPVNLIKDGGQQLTDQYKELN
PMQQVPAVTIDGVTLSQSLAIIQYIEETRPGPALLPADPQKRAKVRMICDLIASGIQPLQ
NLYVLQKIGEDKVSWAQHFIIRGFVALESLLKETAGKYCVGDEISMADICLAPQVYNAER
FKVDVDQFPTIKRLNQTLLALEAFSTSHPSCQPDTPADLRA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtttcgctgcgttgcctcgtaaagcccgttcttcttcatggctatttcagaagt
tcttgctcttggagagttcggattgcatttgcacttaaaggtattgattatgatcaagtt
ccagtaaacctcatcaaagatggaggccagcagttaacagatcagtacaaagaactgaac
cctatgcagcaagtgcccgctgtcaccatagatggcgtgacactgtcccagtcactcgct
attatccagtacattgaggagacgaggccaggtcccgccctgctgcctgcggaccctcag
aagcgggcgaaggtacggatgatctgcgacctcattgcctcgggaatacagcccctgcag
aatctatatgttttacaaaagattggagaagataaagtgtcctgggcacagcatttcata
atcagaggatttgtagctctggagtcactgttgaaagagacagctgggaaatactgtgtc
ggggatgagatctccatggctgacatttgcctggcgccccaggtttataatgccgaaaga
ttcaaagttgatgttgatcagttccccactataaaaaggctgaaccagactctactggca
ctcgaggccttcagcacaagtcacccctcctgccagcctgacactcccgcggacctgaga
gcttag

DBGET integrated database retrieval system