KEGG   Scleropages formosus (Asian bonytongue): 108941723
Entry
108941723         CDS       T04919                                 

Definition
(RefSeq) signal transducer and activator of transcription 3-like
  KO
K04692  signal transducer and activator of transcription 3
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04068  FoxO signaling pathway
sfm04217  Necroptosis
sfm04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108941723
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108941723
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108941723
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sfm03000]
    108941723
Transcription factors [BR:sfm03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    108941723
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 Cas9_a Spectrin Syntaxin-6_N DUF4407
Other DBs
NCBI-GeneID: 108941723
NCBI-ProteinID: XP_018620029
LinkDB
Position
8
AA seq 766 aa
MAQWNQLQQLDPRYLEQLYHLYSDSFPMELRQFLAPWIESQDWGYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQSTT
TATQDGQGVHPSGPVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELTQDLNGSGQAAAIRMKMSQLEQMLSALDGLRRQIVTDMGGLLSAMEFVQKNLLDEE
LADWKRRQQIACIGGPPKICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPVLEEKIVDIFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELN
YQLKIKVCIDKESGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKMDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTFEQLTTLAEKLLGALGNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDINGKTQIQSVEPYTKQQLNSMSFADIIMGYKI
MDATNILVSPLVYLYPEIPKEEAFGKYCRAEAIEQPDMTDPAHVQYLKTKFICVTPTNSS
NTSDLLLMSPQTLDSLIHTEGPEANPGPMESLTLDMELSTDVASPM
NT seq 2301 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttacagcagctggacccgcgctacttggagcagctgtaccac
ctgtacagcgacagcttcccgatggagctacggcagttcctggcaccctggattgagagc
caggactggggatatgcagctaacaaggagtcccacgcaacgctggtcttccataacctg
ctcggtgagatcgaccagcagtacagccgtttcctgcaggagaacaacgtcctgtaccag
cacaacctgcggcgcatcaagcagcacctgcagagcaagtacctggagaagcccatggag
atcgctcgcatcgtggcccgctgcctgtgggaggagcagcggctgctgcagagcaccacc
acagccacacaggatgggcagggggtccacccttctggaccggtggtgacggagaagcag
cagattttggagcacaacctgcaggacatcagaaagagggtgcaggatatggagcagaag
atgaaaatgctggaaaacctgcaggatgactttgacttcaactacaagaccttgaagagt
caaggagagctgacccaggacctgaacggcagcggtcaggcggcagccatcagaatgaag
atgtcccagctagagcagatgttgagcgcgttggatggactgcggaggcaaatcgtgact
gacatggggggtctgctgtcggccatggagttcgtgcagaagaacctgttagacgaggag
ctggccgactggaagaggaggcaacagatcgcttgcatcggcggaccccctaaaatatgc
ctggaccgcctggagacctggatcacgtcgttggcggagtcccagctgcagatccgccag
cagatcaagaagttggaggagctgcagcagaaggtgtcctacaagggagaccccatcatc
cagcaccggcccgtcctggaggagaagatagtggacatctttcggaacttgatgaagagt
gcgtttgtggtggaacggcagccctgcatgcccatgcaccccgacagacctctggtgatc
aagaccggcgttcagttcaccaccaaagtcagattgctggtgaaatttccagagctcaac
taccagctaaaaatcaaagtttgcattgataaagagtcgggggatgtggctgcgctgagg
gggtcccgcaagttcaacatcctgggcaccaacaccaaggtgatgaacatggaggagtcc
aacaacggcagcctctctgctgagttcaaacacctgacgctgagggagcagaggtgtggc
aacgggggacggaccaacagcgacgcctctctgattgtaaccgaagaacttcacctcatc
accttcgagacagaggtgtaccatcaaggcctgaagatggacctggagacccactccttg
ccggtagttgtgatttccaacatctgtcaaatgcctaatgcttgggcctccatcttgtgg
tacaacatgttgaccaatcaccccaagaacgtcaacttcttcacgaagccgcccgtgggt
acttgggaccaggtggccgaggtgctgagctggcagttctcctccacgaccaagagaggc
ctgacctttgagcagctgaccacactggctgagaagctgcttggagcgttagggaactac
tctgggtgccagatcacttgggcaaagttctgcaaagagaacatggcaggcaagggcttc
tccttctgggtgtggctggacaacatcatagacttggtgaagaagtacattttagccctg
tggaacgaaggctacatcatgggcttcatcagcaaggagcgggaaagggccattctgagc
cctaagccacctggaacattcctgctgcgcttcagtgagagcagcaaggagggaggcatc
accttcacctgggtggagaaggacatcaatggaaagacacagatccagtcggtggagccc
tacaccaagcagcaactcaacagcatgtcttttgctgatatcatcatgggttacaagatc
atggatgccaccaacatcctggtgtctccgctggtctacctctacccagagatccccaag
gaggaggcctttggcaagtactgtcgagctgaagccatagagcagcccgacatgactgac
ccagctcacgtccagtacttgaagacaaaattcatctgtgtgacgcccaccaattccagc
aacaccagcgacctactcctcatgtctcctcaaaccctggactccctgatacacaccgag
ggtccagaggccaaccctgggccaatggaatcactcactctggacatggagctaagcacc
gatgtggcctcacccatgtga

DBGET integrated database retrieval system