KEGG   Scleropages formosus (Asian bonytongue): 108941810Help
Entry
108941810         CDS       T04919                                 

Definition
(RefSeq) glycogen [starch] synthase, muscle-like
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00500  Starch and sucrose metabolism
sfm01100  Metabolic pathways
sfm04910  Insulin signaling pathway
Module
sfm_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    108941810
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108941810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sfm01003]
    108941810
Enzymes [BR:sfm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     108941810
Glycosyltransferases [BR:sfm01003]
 Polysaccharide
  Storage polysaccharide
   108941810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 108941810
NCBI-ProteinID: XP_018620186
UniProt: A0A1W5B4U1
LinkDB All DBs
Position
Unknown
AA seq 734 aa AA seqDB search
MPLTRSVSVTSLSGLDEWDEEFDLEDAVLFEIAWEVANKVGGIYTVIQTKARLTSEEWGE
NYFLVGPYTESNVRTQVELIEPTNGVLRRTIDKMNASGCKVYFGRWLIEGSPYVVLIDVG
FTAWSLDRWKSELWESCAIGVPWFDREANDAVLFGFLTAWLLGEFAAQCDEPPCILAHFH
EWLAGLGLVLCRNRRLPVATIFTTHATLLGRYLCAGNVDFYNNLSQFNVDKEAGDRQIYH
RYCIERAAAHCTHVFTTVSQITAIEAEHLLKRKPDLVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKCLFFFIAGRYEFCNKGADIFLEALARLNYLLRVNHSEV
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTAHAVKEKFGKKLYESLLVGQLPDVSKML
DKEDFTMMKRAIFSTQRHSQPPVCTHNMLEDSSDPILTCIRRIGLFNGSADRVKVIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSIDESCHQLTSFLFQFCQQSRRQRIIQRNRTERLSDLLDWRY
LGRYYISARHMALAKAFPDTYCYEPQEPPSTQGFRYPRPASVPPSPALSRHSSPHHSEAE
DEDDERYDEDLEAEKDRQNIRQPFSLPLRNKGALPYSMAASEGDGSPAPSPPSSIPSPPS
SITSPSDSMCSEKN
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcactcgcagcgtctcggtgacgtccctctcgggcctcgatgagtgggacgag
gagtttgacctggaggatgccgtgctctttgagatcgcctgggaggtggccaataaagtg
ggcgggatttacaccgtgattcagaccaaggcgcgtctcacctccgaggagtggggcgag
aactacttcctggtaggaccgtacacggaaagcaacgtgcgcacgcaggtggagctgata
gagccgaccaatggggtgctgcggaggaccatcgacaagatgaacgcgagtggatgtaag
gtgtacttcggtcgctggctaatcgagggcagtccctacgtggtgctcatcgacgtgggc
ttcaccgcttggtcgctggaccgctggaagagtgagctgtgggagagctgcgccatcggg
gtgccgtggttcgaccgcgaggccaacgacgccgtgctcttcggcttcctcaccgcctgg
ctactcggggagtttgcggcacagtgcgacgagcccccctgcatcctggcgcacttccac
gagtggctcgcggggctcggcctcgttctctgccgcaatagacgtctcccggtggcgacc
atcttcacaacccacgccaccctgctggggcgctacctgtgcgccggcaacgtggacttc
tacaacaacttgagtcagttcaacgtggacaaggaggccggcgaccggcagatctaccac
cggtactgcattgagcgcgcggcggcccactgcacccatgtcttcaccaccgtctcccag
atcaccgccatcgaggccgagcacctgctcaagaggaagccagacctcgtcacccccaac
gggctcaacgtgaagaagttctctgcgatgcacgagttccagaaccttcacgcccagagc
aaggcgcgcatccaggagtttgtccgcggccacttctacgggcacttggacttcaacctg
gacaagtgtctcttcttcttcatcgccggaagatacgagttctgcaacaagggtgccgac
atcttcttggaggctctcgcgcgcctcaactacctgctgagggtgaaccacagcgaagtg
accgttgtggccttcttcatcatgcccgcccgcaccaacaacttcaatgtggagacgctc
aagggccaggcggtcaggaaacagctctgggacacggcacatgcggtcaaggagaagttt
gggaagaagctgtatgagtcgctgctggtggggcagctgcccgacgtgtccaagatgctg
gacaaggaggacttcaccatgatgaagagagccatcttcagcacgcagcgccacagccag
ccacccgtgtgcacccacaacatgctggaggacagcagcgaccctatccttacctgcatc
cgccgcatcggcctcttcaacggctccgccgaccgcgtcaaggtgatcttccacccggag
ttcctgtcctcaacgtcccccctgctgcccatggactacgaggagtttgtgcgcggttgc
cacctgggcgtcttcccctcctactacgagccctggggctacacgccagccgagtgcacg
gtcatggggattccctccgtttccaccaacctgtccggctttggctgcttcatggaggag
cacatcgccgacccgtcggcctacggaatctacatcctggaccggcgctttcgcagcatc
gacgagtcatgccaccagctcacctccttcctcttccagttctgccagcagagtcggcgc
cagcgcatcatccagcggaaccgcactgagcgcctcagcgacctgcttgactggcgctac
ctgggccggtactacatctcagcacgccacatggccctggccaaggcctttccagacacc
tactgctacgagcctcaggagccgccctccacccagggcttccgctaccctcgtcccgcc
tcggtgccgccctcccccgccctgtcgcgccactcctccccccaccacagcgaggccgaa
gacgaggatgacgagagatatgacgaggatctggaggccgagaaggaccgccagaacatc
cgccagcctttctctctgccgctcaggaacaagggcgcactgccgtactccatggccgcc
tccgagggcgatggcagccctgccccctccccgcccagctccatcccctcccctcccagc
tccatcacatctccttcggactccatgtgtagtgagaagaactga

DBGET integrated database retrieval system